KEGG   Homo sapiens (human): 51096Help
Entry
51096             CDS       T01001                                 

Gene name
UTP18, CGI-48, WDR50
Definition
(RefSeq) UTP18, small subunit processome component
  KO
K14553  U3 small nucleolar RNA-associated protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    51096 (UTP18)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    51096 (UTP18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Cytochrom_D1 WD40_like Hira Pox_D5
Motif
Other DBs
NCBI-GeneID: 51096
NCBI-ProteinID: NP_057085
OMIM: 612816
HGNC: 24274
Ensembl: ENSG00000011260
Vega: OTTHUMG00000162370
Pharos: Q9Y5J1(Tdark)
UniProt: Q9Y5J1
Position
17q21.33
AA seq 556 aa AA seqDB search
MPPERRRRMKLDRRTGAKPKRKPGMRPDWKAGAGPGGPPQKPAPSSQRKPPARPSAAAAA
IAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVENDEDALLRRLRGPRVQEHED
SGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKK
RLKEEFQHAMGGVPAWAETTKRKTSSDDESEEDEDDLLQRTGNFISTSTSLPRGILKMKN
CQHANAERPTVARISSVQFHPGAQIVMVAGLDNAVSLFQVDGKTNPKIQSIYLERFPIFK
ACFSANGEEVLATSTHSKVLYVYDMLAGKLIPVHQVRGLKEKIVRSFEVSPDGSFLLING
IAGYLHLLAMKTKELIGSMKINGRVAASTFSSDSKKVYASSGDGEVYVWDVNSRKCLNRF
VDEGSLYGLSIATSRNGQYVACGSNCGVVNIYNQDSCLQETNPKPIKAIMNLVTGVTSLT
FNPTTEILAIASEKMKEAVRLVHLPSCTVFSNFPVIKNKNISHVHTMDFSPRSGYFALGN
EKGKALMYRLHHYSDF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggagcggaggagacgaatgaaactggaccggagaaccggagcgaagccgaag
cggaagcccggaatgaggccggactggaaagccggagcggggccaggcgggcctccccaa
aagcctgccccttcatcccagcggaaaccgccggcccggccgagcgcggcggccgctgcg
attgcagtcgcggcggcggaggaagagagacggctccggcagcggaaccgcctgaggctg
gaggaggacaaaccggccgtggagcggtgcttggaggagctggtcttcggcgacgtcgag
aacgacgaggacgcgttgctgcggcgtctgcgaggcccgagggttcaagaacatgaagac
tcgggtgactcagaagtggagaatgaagcaaaaggtaattttccacctcaaaagaagcca
gtttgggtggatgaagaagatgaagatgaggaaatggttgacatgatgaacaatcggttt
cggaaggatatgatgaaaaatgctagtgaaagtaaactttcgaaagacaaccttaaaaag
agacttaaagaagaattccaacatgccatgggaggagtacctgcctgggcagagactact
aagcggaaaacatcttcagatgatgaaagtgaagaggatgaagatgatttgttgcaaagg
actgggaatttcatatccacatcaacttctcttccaagaggaatcttgaagatgaagaac
tgccagcatgcgaatgctgaacgtcctactgttgctcggatctcatctgtgcagttccat
cccggtgcacagattgtgatggttgctggattagataatgctgtatcactatttcaggtt
gatgggaaaacaaatcctaaaattcagagcatctatttggaaaggtttccaatctttaag
gcttgttttagtgctaatggggaagaagttttagccacgagtacccacagcaaggttctt
tatgtctatgacatgctggctggaaagttaattcctgtgcatcaagtgagaggtttgaaa
gagaagatagtgaggagctttgaagtctccccagatgggtccttcttgctcataaatggc
attgctggatatttgcatttgctagcaatgaagaccaaagaactgattggaagcatgaaa
attaatggaagggttgcagcatccacattctcttcagatagtaagaaagtatacgcctct
tcgggggatggagaagtttatgtttgggatgtgaactcaaggaagtgccttaacagattt
gttgatgaaggcagtttatatggattaagcattgccacatctaggaatggacagtatgtt
gcttgtggttctaattgtggagtggtaaatatatacaatcaagattcttgtctccaagaa
acaaacccaaagccaataaaagctataatgaacttggttacaggtgttacttctctgacc
ttcaatcctactacagaaatcttggcaattgcttcagaaaaaatgaaagaagcagtcaga
ttggttcatcttccttcctgtacagtattttcaaacttcccagtcattaaaaataagaat
atttctcatgttcataccatggatttttctccgagaagtggatactttgccttggggaat
gaaaagggcaaggccctgatgtataggttgcaccattactcagacttctaa

DBGET integrated database retrieval system