KEGG   Homo sapiens (human): 51096
Entry
51096             CDS       T01001                                 
Symbol
UTP18, CGI-48, WDR50
Name
(RefSeq) UTP18 small subunit processome component
  KO
K14553  U3 small nucleolar RNA-associated protein 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    51096 (UTP18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    51096 (UTP18)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    51096 (UTP18)
SSDB
Motif
Pfam: WD40 Cytochrom_D1 NBCH_WD40 WD40_like Hira Pox_D5 PQQ_3
Other DBs
NCBI-GeneID: 51096
NCBI-ProteinID: NP_057085
OMIM: 612816
HGNC: 24274
Ensembl: ENSG00000011260
Pharos: Q9Y5J1(Tdark)
UniProt: Q9Y5J1
Structure
Position
17:51260546..51297933
AA seq 556 aa
MPPERRRRMKLDRRTGAKPKRKPGMRPDWKAGAGPGGPPQKPAPSSQRKPPARPSAAAAA
IAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVENDEDALLRRLRGPRVQEHED
SGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKK
RLKEEFQHAMGGVPAWAETTKRKTSSDDESEEDEDDLLQRTGNFISTSTSLPRGILKMKN
CQHANAERPTVARISSVQFHPGAQIVMVAGLDNAVSLFQVDGKTNPKIQSIYLERFPIFK
ACFSANGEEVLATSTHSKVLYVYDMLAGKLIPVHQVRGLKEKIVRSFEVSPDGSFLLING
IAGYLHLLAMKTKELIGSMKINGRVAASTFSSDSKKVYASSGDGEVYVWDVNSRKCLNRF
VDEGSLYGLSIATSRNGQYVACGSNCGVVNIYNQDSCLQETNPKPIKAIMNLVTGVTSLT
FNPTTEILAIASEKMKEAVRLVHLPSCTVFSNFPVIKNKNISHVHTMDFSPRSGYFALGN
EKGKALMYRLHHYSDF
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgccgccggagcggaggagacgaatgaaactggaccggagaaccggagcgaagccgaag
cggaagcccggaatgaggccggactggaaagccggagcggggccaggcgggcctccccaa
aagcctgccccttcatcccagcggaaaccgccggcccggccgagcgcggcggccgctgcg
attgcagtcgcggcggcggaggaagagagacggctccggcagcggaaccgcctgaggctg
gaggaggacaaaccggccgtggagcggtgcttggaggagctggtcttcggcgacgtcgag
aacgacgaggacgcgttgctgcggcgtctgcgaggcccgagggttcaagaacatgaagac
tcgggtgactcagaagtggagaatgaagcaaaaggtaattttccacctcaaaagaagcca
gtttgggtggatgaagaagatgaagatgaggaaatggttgacatgatgaacaatcggttt
cggaaggatatgatgaaaaatgctagtgaaagtaaactttcgaaagacaaccttaaaaag
agacttaaagaagaattccaacatgccatgggaggagtacctgcctgggcagagactact
aagcggaaaacatcttcagatgatgaaagtgaagaggatgaagatgatttgttgcaaagg
actgggaatttcatatccacatcaacttctcttccaagaggaatcttgaagatgaagaac
tgccagcatgcgaatgctgaacgtcctactgttgctcggatctcatctgtgcagttccat
cccggtgcacagattgtgatggttgctggattagataatgctgtatcactatttcaggtt
gatgggaaaacaaatcctaaaattcagagcatctatttggaaaggtttccaatctttaag
gcttgttttagtgctaatggggaagaagttttagccacgagtacccacagcaaggttctt
tatgtctatgacatgctggctggaaagttaattcctgtgcatcaagtgagaggtttgaaa
gagaagatagtgaggagctttgaagtctccccagatgggtccttcttgctcataaatggc
attgctggatatttgcatttgctagcaatgaagaccaaagaactgattggaagcatgaaa
attaatggaagggttgcagcatccacattctcttcagatagtaagaaagtatacgcctct
tcgggggatggagaagtttatgtttgggatgtgaactcaaggaagtgccttaacagattt
gttgatgaaggcagtttatatggattaagcattgccacatctaggaatggacagtatgtt
gcttgtggttctaattgtggagtggtaaatatatacaatcaagattcttgtctccaagaa
acaaacccaaagccaataaaagctataatgaacttggttacaggtgttacttctctgacc
ttcaatcctactacagaaatcttggcaattgcttcagaaaaaatgaaagaagcagtcaga
ttggttcatcttccttcctgtacagtattttcaaacttcccagtcattaaaaataagaat
atttctcatgttcataccatggatttttctccgagaagtggatactttgccttggggaat
gaaaagggcaaggccctgatgtataggttgcaccattactcagacttctaa

DBGET integrated database retrieval system