KEGG   Homo sapiens (human): 51098Help
Entry
51098             CDS       T01001                                 

Gene name
IFT52, C20orf9, CGI-53, NGD2, NGD5
Definition
(RefSeq) intraflagellar transport 52
  KO
K19681  intraflagellar transport protein 52
Organism
hsa  Homo sapiens (human)
Disease
H02157  Short-rib thoracic dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    51098 (IFT52)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex B
    51098 (IFT52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_transp_aux DDOST_48kD
Motif
Other DBs
NCBI-GeneID: 51098
NCBI-ProteinID: NP_001290387
OMIM: 617094
HGNC: 15901
Ensembl: ENSG00000101052
Vega: OTTHUMG00000032513
Pharos: Q9Y366(Tdark)
UniProt: Q9Y366
Position
20q13.12
AA seq 437 aa AA seqDB search
MEKELRSTILFNAYKKEIFTTNNGYKSMQKKLRSNWKIQSLKDEITSEKLNGVKLWITAG
PREKFTAAEFEILKKYLDTGGDVFVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVY
HKYFHPKEALVSSGVLNREISRAAGKAVPGIIDEESSGNNAQALTFVYPFGATLSVMKPA
VAVLSTGSVCFPLNRPILAFYHSKNQGGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQWL
TTGDIHLNQIDAEDPEISDYMMLPYTATLSKRNRECLQESDEIPRDFTTLFDLSIFQLDT
TSFHSVIEAHEQLNVKHEPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETF
SSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDAKHILEHVFFQVVEFKKL
NQEHDIDTSETAFQNNF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagagctgcggagcaccattcttttcaatgcctacaaaaaggagatatttacc
accaacaatggctacaaatccatgcagaaaaaacttcggagtaattggaagattcagagc
ttaaaagatgaaatcacatctgagaagttaaatggagtgaaactgtggattacagctggg
ccaagggaaaaatttactgcagctgagtttgaaatcctgaagaaatatcttgacactggt
ggagatgtctttgtgatgctaggagaaggtggagaatccagatttgacaccaatattaac
tttttactagaagaatatggaatcatggttaataatgatgctgtggttagaaatgtatat
cacaaatatttccatcctaaagaagctctagtttccagtggagtcttgaacagggaaatt
agccgagctgcaggaaaggctgtgcctgggatcattgatgaggaaagcagtggaaacaat
gcccaggctctcacctttgtgtatccttttggtgccacattgagtgtcatgaaaccagca
gtggcggttctgtctacaggttctgtctgcttcccacttaacagacccattttggctttc
tatcactcaaagaaccaaggtgggaagctggcagtgcttggttcatgtcacatgttcagt
gatcaatatttggacaaagaagaaaacagcaaaatcatggatgttgttttccagtggctc
acgacaggagacatccacctaaaccagattgatgctgaggacccagagatttctgactac
atgatgctgccctacacagccaccctatcaaagcggaatcgagagtgtctccaggagagt
gatgagatcccaagggactttaccaccctcttcgacctgtccatcttccagctggatacc
acctccttccacagcgtcatcgaggctcacgagcagctaaatgtgaaacatgaaccactc
cagctcatccagcctcagtttgagacgccgctgccaacccttcagcctgcggtttttcct
cccagtttccgggagttaccacctcctcctctggagctatttgatttagatgaaacgttc
tcctctgagaaggcacggctggctcagattaccaataagtgtactgaagaagacctggaa
ttttatgtcaggaagtgtggtgatattcttggagtaaccagtaaactaccaaaggaccaa
caggatgccaaacatatccttgagcacgtcttcttccaagtggtggagttcaagaaattg
aaccaggaacatgacatcgatacaagtgaaacagcattccagaacaatttctga

DBGET integrated database retrieval system