KEGG   Homo sapiens (human): 51099Help
Entry
51099             CDS       T01001                                 

Gene name
ABHD5, CGI58, IECN2, NCIE2
Definition
(RefSeq) abhydrolase domain containing 5
  KO
K13699  abhydrolase domain-containing protein 5 [EC:2.3.1.51]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04923  Regulation of lipolysis in adipocytes
Disease
H00736  Dorfman-Chanarin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    51099 (ABHD5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    51099 (ABHD5)
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    51099 (ABHD5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     51099 (ABHD5)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S33
   51099 (ABHD5)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   51099 (ABHD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF2251 DUF1071
Motif
Other DBs
NCBI-GeneID: 51099
NCBI-ProteinID: NP_057090
OMIM: 604780
HGNC: 21396
Ensembl: ENSG00000011198
Vega: OTTHUMG00000133039
Pharos: Q8WTS1(Tbio)
UniProt: Q8WTS1 A0A0S2Z5D6
Position
3p21.33
AA seq 349 aa AA seqDB search
MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNG
NKIWTLKFSHNISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRF
DSDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWG
FPERPDLADQDRPIPVWIRALGAALTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYSSMF
EDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCI
DGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaggaggaggaggtggactctgccgacaccggagagaggtcaggatggcta
actggttggctccccacatggtgccctacgtctatatcacaccttaaagaagctgaagag
aagatgttaaaatgtgtgccttgcacatacaaaaaagaacctgttcgtatatctaatgga
aataaaatatggacactgaagttctctcataatatttcaaataagactccacttgtcctt
ctccatggttttggaggaggtcttgggctctgggcactgaattttggagatctttgcacc
aacagacctgtctatgcttttgacctattgggttttggacgaagtagtagacccaggttt
gacagtgatgcagaagaagtggagaatcagtttgtggaatccattgaagagtggagatgt
gccctaggattggacaaaatgatcttgcttgggcacaacctaggtggattcttggctgct
gcttactcgctgaagtacccatcaagggttaatcatctcattttagtggagccttggggt
ttccctgaacgaccagaccttgctgatcaagacagaccaattccagtttggatcagagcc
ttgggagcagcattgactccctttaaccctttagctggcctaaggattgcaggacccttt
ggtttaagtctagtgcagcgtttaaggcctgatttcaaacgaaagtattcttcaatgttc
gaagacgatactgtgacagaatacatctaccactgtaatgtgcagactccaagtggtgag
acagctttcaagaatatgactattccttatggatgggcaaaaaggccaatgctccagcga
attggtaaaatgcaccctgacattccagtttcagtgatctttggcgcccgatcctgcata
gatggcaattctggcaccagcatccagtccttacgaccacattcatatgtgaagacaata
gctattcttggggcaggacattatgtatatgcagatcaaccagaagaattcaaccagaaa
gtaaaggagatctgcgacactgtggactga

DBGET integrated database retrieval system