KEGG   Homo sapiens (human): 51102
Entry
51102             CDS       T01001                                 

Gene name
MECR, CGI-63, DYTOABG, ETR1, FASN2B, NRBF1
Definition
(RefSeq) mitochondrial trans-2-enoyl-CoA reductase
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00062  Fatty acid elongation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00085  Fatty acid elongation in mitochondria
hsa_M00873  Fatty acid biosynthesis in mitochondria, animals
Disease
H00831  Primary dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    51102 (MECR)
   00062 Fatty acid elongation
    51102 (MECR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     51102 (MECR)
    1.3.1.-  
     51102 (MECR)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 PALP
Other DBs
NCBI-GeneID: 51102
NCBI-ProteinID: NP_057095
OMIM: 608205
HGNC: 19691
Ensembl: ENSG00000116353
Vega: OTTHUMG00000059082
Pharos: Q9BV79(Tbio)
UniProt: Q9BV79
Structure
PDB: 
1ZSY 2VCY

Position
1p35.3
AA seq 373 aa
MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVEL
KNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGFLPELPAVGGNEGVAQVVAVGSNVT
GLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQ
LQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEE
ELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLL
IFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEAS
MKPFISSKQILTM
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtgggtctgcagtaccctgtggcgggtgcgaacccccgcccggcagtggcgggggctg
ctcccagcttctggctgtcacggacctgccgcctcctcctactccgcatccgccgagcct
gcccgggtccgggcgcttgtctatgggcaccacggggatccagccaaggtcgtcgaactc
aagaacctggagctagctgctgtgagaggatcagatgtccgtgtgaagatgctggcggcc
cctatcaatccatctgacataaatatgatccaaggaaactacggattccttcctgaactg
cctgctgttggagggaacgaaggtgttgcacaggtggtagcggtgggcagcaatgtgacc
gggctgaagccaggagactgggtgattccagcaaatgctggtttaggaacctggcggacc
gaggctgtgttcagcgaggaagcactgatccaagttccgagtgacatccctcttcagagc
gctgccaccctgggtgtcaatccctgcacagcctacaggatgttgatggacttcgagcaa
ctgcagccaggggattctgtcatccagaatgcatccaacagcggagtggggcaagcagtc
atccagatcgccgcagccctgggcctaagaaccatcaatgtggtccgagacagacctgat
atccagaagctgagtgacagactgaagagtctgggggctgagcatgtcatcacagaagag
gagctaagaaggcccgaaatgaaaaacttctttaaggacatgccccagccacggcttgct
ctcaactgtgttggtgggaaaagctccacagagctgctgcggcagttagcgcgtggagga
accatggtaacctatggggggatggccaagcagcccgtcgtagcctctgtgagcctgctc
atttttaaggatctcaaacttcgaggcttttggttgtcccagtggaagaaggatcacagt
ccagaccagttcaaggagctgatcctcacactgtgcgatctcatccgccgaggccagctc
acagcccctgcctgctcccaggtcccgctgcaggactaccagtctgccttggaagcctcc
atgaagcccttcatatcttcaaagcagattctcaccatgtga

DBGET integrated database retrieval system