KEGG   Homo sapiens (human): 51103
Entry
51103             CDS       T01001                                 
Symbol
NDUFAF1, CGI-65, CGI65, CIA30, MC1DN11
Name
(RefSeq) NADH:ubiquinone oxidoreductase complex assembly factor 1
  KO
K18159  NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Network
nt06529  Thermogenesis
  Element
N01691  mitochondrial complex - UCP1 in Thermogenesis
Disease
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    51103 (NDUFAF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51103 (NDUFAF1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    51103 (NDUFAF1)
SSDB
Motif
Pfam: CIA30 CBM_11 DUF2089
Other DBs
NCBI-GeneID: 51103
NCBI-ProteinID: NP_057097
OMIM: 606934
HGNC: 18828
Ensembl: ENSG00000137806
UniProt: Q9Y375
Position
15:complement(41387353..41403026)
AA seq 327 aa
MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQ
GDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQ
AKVVWQFRGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRS
GYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYF
MFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDF
IGVFTDPAHTEEFAYENSPELNPRLFK
NT seq 984 nt   +upstreamnt  +downstreamnt
atggctttggttcacaaattgctgcgtggtacttattttctcagaaaattctctaagcca
acttctgccttgtatccatttttgggtattcgctttgcagagtattccagtagtcttcag
aaaccagtggcttctcctggcaaagcctcctcacagaggaagactgaaggggatttgcaa
ggagatcaccagaaagaagttgctttggatataacttcttctgaggagaagcctgatgtt
agtttcgataaagcaattagagatgaagcaatataccattttaggcttttgaaggatgaa
attgtggatcattggagaggaccggaaggccaccctctgcatgaggtcttgctggaacaa
gccaaggttgtctggcaattccgggggaaagaagatttggataagtggacagtgacttct
gataagacgattggaggcagaagtgaagtgtttttgaaaatgggcaagaataaccaaagt
gcactgctatatggaactctgagctctgaggcgcctcaggacggggagtctacccgaagt
gggtactgtgcaatgatatccaggattccaaggggtgcttttgagaggaagatgtcttac
gattggtcccagttcaatactctgtatctccgtgtacgtggggatggtcggccttggatg
gtgaatatcaaggaggacacagatttcttccagaggacgaatcagatgtatagttacttc
atgttcacccgcgggggaccctactggcaggaggtcaagattcctttttccaaatttttc
ttctctaatcgaggaagaatccgggatgttcagcatgagcttccgcttgataagatctct
tctataggattcaccttggctgataaagtggatggtccattcttcctggagatagatttt
attggcgtgtttactgatccagctcatacagaagaatttgcctatgaaaattctccagag
cttaacccaaggctttttaaataa

DBGET integrated database retrieval system