KEGG   Homo sapiens (human): 51104Help
Entry
51104             CDS       T01001                                 

Gene name
ABHD17B, C9orf77, CGI-67, FAM108B1
Definition
(RefSeq) abhydrolase domain containing 17B
  KO
K01076  abhydrolase domain-containing protein 17 [EC:3.1.2.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    51104 (ABHD17B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     51104 (ABHD17B)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   51104 (ABHD17B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Peptidase_S9 Abhydrolase_1 DLH UPF0227 FSH1 Abhydrolase_5 DUF818 Asp2 Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 51104
NCBI-ProteinID: NP_001020951
OMIM: 617943
HGNC: 24278
Ensembl: ENSG00000107362
Vega: OTTHUMG00000020001
Pharos: Q5VST6(Tdark)
UniProt: Q5VST6 A0A384MEH9
Position
9q21.13
AA seq 288 aa AA seqDB search
MNNLSFSELCCLFCCPPCPGKIASKLAFLPPDPTYTLMCDESGSRWTLHLSERADWQYSS
REKDAIECFMTRTSKGNRIACMFVRCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINC
NIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRYGIRPENVIIYGQSIGTVPSVDLA
ARYESAAVILHSPLTSGMRVAFPDTKKTYCFDAFPNIDKISKITSPVLIIHGTEDEVIDF
SHGLALFERCQRPVEPLWVEGAGHNDVELYGQYLERLKQFVSQELVNL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaataatctttcatttagtgagctatgttgcctcttctgctgtccaccttgtccaggg
aagattgcttcaaaattagcgtttttgccacctgatccaacttacacactgatgtgtgat
gaaagcggaagccgttggactttacatctgtctgaacgagcagactggcagtattcttct
agagaaaaagatgctattgagtgtttcatgactagaaccagtaaaggcaacagaattgct
tgtatgtttgtacgttgttcacccaatgcgaaatacactttactcttctcacatggaaat
gctgttgatcttggtcaaatgagcagcttttacataggactaggatcacggattaattgt
aatatattctcatatgattattctggatatggtgccagttccgggaaacccacagagaag
aacctctatgcagacattgaagctgcttggcttgctcttaggacaagatatggcattcgc
cctgaaaatgtgattatatatggccaaagtatagggacagtaccgtctgtggatcttgct
gctcgatatgagagtgctgctgttattcttcattctcctctgacttcgggaatgcgagtt
gcctttcctgataccaagaagacctactgttttgatgcattcccaaacattgacaaaatc
tctaagataacctctccagtattaataattcatgggactgaagatgaagtcattgacttt
tcacatggcctcgcattgtttgaacgttgccaaagacctgtggagcctctctgggttgaa
ggagcaggtcacaatgatgtggaactttatggacagtatcttgaaaggttgaaacagttt
gtgtcacaggaactggtaaatttgtaa

DBGET integrated database retrieval system