KEGG   Homo sapiens (human): 51106
Entry
51106             CDS       T01001                                 

Gene name
TFB1M, CGI-75, CGI75, mtTFB, mtTFB1
Definition
(RefSeq) transcription factor B1, mitochondrial
  KO
K15266  dimethyladenosine transferase 1, mitochondrial [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    51106 (TFB1M)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51106 (TFB1M)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     51106 (TFB1M)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   51106 (TFB1M)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial transcription factors
    51106 (TFB1M)
SSDB
Motif
Pfam: RrnaAD
Other DBs
NCBI-GeneID: 51106
NCBI-ProteinID: NP_057104
OMIM: 607033
HGNC: 17037
Ensembl: ENSG00000029639
Vega: OTTHUMG00000015881
Pharos: Q8WVM0(Tbio)
UniProt: Q8WVM0 E5KTM5
Structure
PDB: 
6AAX 6AJK

Position
6q25.3
AA seq 346 aa
MAASGKLSTCRLPPLPTIREIIKLLRLQAAKQLSQNFLLDLRLTDKIVRKAGNLTNAYVY
EVGPGPGGITRSILNADVAELLVVEKDTRFIPGLQMLSDAAPGKLRIVHGDVLTFKVEKA
FSESLKRPWEDDPPNVHIIGNLPFSVSTPLIIKWLENISCRDGPFVYGRTQMTLTFQKEV
AERLAANTGSKQRSRLSVMAQYLCNVRHIFTIPGQAFVPKPEVDVGVVHFTPLIQPKIEQ
PFKLVEKVVQNVFQFRRKYCHRGLRMLFPEAQRLESTGRLLELADIDPTLRPRQLSISHF
KSLCDVYRKMCDEDPQLFAYNFREELKRRKSKNEEKEEDDAENYRL
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggctgcctccggaaaactcagcacttgccgtctccctccgttgcccacgattcgagaa
atcattaagttgttaagactgcaagcagcgaagcagctatcacagaatttcctcctggac
ttgaggctgacagataagattgtaaggaaagctggcaatctgacaaatgcttatgtttac
gaagtgggccctgggccagggggaatcacaagatctattcttaatgccgacgtcgctgaa
cttctggtggttgaaaaggacactcgatttattcctggattacagatgctttctgatgca
gcacctgggaaactgagaattgttcatggagatgtcttgacatttaaggtagaaaaggct
ttttcagaaagtcttaaaagaccctgggaagatgatcctccaaatgtacatattattgga
aatctgccttttagtgtttcaactccactgattatcaagtggcttgaaaatatttcctgt
agagatggaccttttgtttatggcagaactcagatgactttgacttttcaaaaggaagtg
gcagagagacttgcagccaatacaggaagcaaacagcgtagtcgcctctctgttatggct
cagtacctctgcaatgttcgacacatctttacgattccaggacaagcttttgtccccaaa
ccagaggtggacgtgggcgtggtgcacttcactcccttgatacagcccaagatagagcag
ccattcaagctggtggaaaaagtggttcagaatgtatttcagttccgaaggaaatactgc
catcgagggctcagaatgttattccctgaagcgcagcgcttggaaagcacgggcaggctg
ttagagttggcagacatagaccctactcttcggccccgccagctctccatctcacacttt
aagagcctctgtgatgtatacagaaaaatgtgtgatgaagacccacaactctttgcatat
aatttcagagaagaactcaagcgaagaaaaagcaaaaatgaagaaaaagaagaggatgac
gcagagaattacagactctag

DBGET integrated database retrieval system