KEGG   Homo sapiens (human): 51110Help
Entry
51110             CDS       T01001                                 

Gene name
LACTB2, CGI-83
Definition
(RefSeq) lactamase beta 2
  KO
K16639  endoribonuclease LACTB2 [EC:3.1.27.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51110 (LACTB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.-  
     51110 (LACTB2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    51110 (LACTB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BLACT_WH Lactamase_B Lactamase_B_2 E2_bind Metallophos_3 DUF5617
Motif
Other DBs
NCBI-GeneID: 51110
NCBI-ProteinID: NP_057111
HGNC: 18512
Ensembl: ENSG00000147592
Vega: OTTHUMG00000164430
Pharos: Q53H82(Tdark)
UniProt: Q53H82 A0A024R811
Structure
PDB: 

Position
8q13.3
AA seq 288 aa AA seqDB search
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLK
QALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQ
YVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDY
MNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVME
LVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtactgcagcgcgtcgagcggctgtccaatcgagtcgtgcgtgtgttgggc
tgtaacccgggtcccatgaccctccaaggcaccaacacctacctagtggggaccggcccc
aggagaatcctcattgacactggagaaccagcaattccagaatacatcagctgtttaaag
caggctctaactgaatttaacacagcaatccaggaaattgtagtgactcactggcaccga
gatcattctggaggcataggagatatttgtaaaagcatcaataatgacactacctattgc
attaaaaaactcccacggaatcctcagagagaagaaattataggaaatggagagcaacaa
tatgtttatctgaaagatggagatgtgattaagactgagggagccactctaagagttcta
tatacccctggccacactgatgatcacatggctctactcttagaagaggaaaatgctatc
ttttctggagattgcatcctaggggaaggaacaacggtatttgaagacctctatgattat
atgaactctttaaaagagttattgaaaatcaaagctgatattatatatccaggacatggc
ccagtaattcataatgctgaagctaaaattcaacaatacatttctcacagaaatattcga
gagcagcaaattcttacattatttcgtgagaactttgagaaatcatttacagtaatggag
cttgtaaaaattatttacaagaatactcctgagaatttacatgaaatggctaaacataat
ctcttacttcatttgaaaaaactagaaaaagaaggaaaaatatttagcaacacagatcct
gacaagaaatggaaagctcatctttag

DBGET integrated database retrieval system