KEGG   Homo sapiens (human): 51118Help
Entry
51118             CDS       T01001                                 

Gene name
UTP11, CGI-94, CGI94, UTP11L
Definition
(RefSeq) UTP11 small subunit processome component
  KO
K14769  U3 small nucleolar RNA-associated protein 11
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    51118 (UTP11)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    51118 (UTP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Utp11
Motif
Other DBs
NCBI-GeneID: 51118
NCBI-ProteinID: NP_057121
OMIM: 609440
HGNC: 24329
Ensembl: ENSG00000183520
Vega: OTTHUMG00000004435
Pharos: Q9Y3A2(Tbio)
UniProt: Q9Y3A2
Position
1p34.3
AA seq 253 aa AA seqDB search
MAAAFRKAAKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKALE
KNPDEFYYKMTRVKLQDGVHIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLK
SELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPELVDRVFNRPRIETLQKEKVK
GVTNQTGLKRIAKERQKQYNCLTQRIEREKKLFVIAQKIQTRKDLMDKTQKVKVKKETVN
SPAIYKFQSRRKR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcttttcggaaggcggctaagtcccggcagcgggaacacagagagcgaagc
cagcctggctttcgaaaacatctgggcctgctggagaaaaagaaagattacaaacttcgt
gcagatgactaccgtaaaaaacaagaatacctcaaagctcttcggaagaaggctcttgaa
aaaaatccagatgaattctactacaaaatgactcgggttaaactccaggatggagtacat
attattaaggagactaaggaagaagtaaccccagaacaactaaagctgatgagaactcag
gacgtcaaatatatagaaatgaagagggttgcagaagctaagaaaatcgaaagactaaaa
tcagagctccatctgctggatttccaggggaagcaacagaacaagcatgtgttctttttt
gacaccaaaaaggaagttgaacagtttgatgtcgcaactcacctgcaaacagccccggag
ctagtcgacagagtctttaataggcccaggatagagaccttgcagaaagaaaaagtgaaa
ggagttaccaatcagactggacttaagcgaatagctaaagaaaggcaaaagcagtataac
tgcctgacacagcggattgaacgagagaagaaattgttcgttattgctcagaaaattcaa
acacgcaaagatcttatggataaaactcagaaagtgaaggtgaagaaagaaacggtgaac
tccccagctatttataaatttcagagtcgtcgaaaacgttga

DBGET integrated database retrieval system