KEGG   Homo sapiens (human): 51119Help
Entry
51119             CDS       T01001                                 

Gene name
SBDS, CGI-97, SDS, SWDS
Definition
(RefSeq) SBDS, ribosome maturation factor
  KO
K14574  ribosome maturation protein SDO1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Disease
H00101  Other phagocyte defects
H00439  Shwachman-Diamond syndrome
H00479  Metaphyseal dysplasias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    51119 (SBDS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    51119 (SBDS)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    51119 (SBDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBDS_C SBDS 2-Hacid_dh_C MOLO1 Guanylin
Motif
Other DBs
NCBI-GeneID: 51119
NCBI-ProteinID: NP_057122
OMIM: 607444
HGNC: 19440
Ensembl: ENSG00000126524
Vega: OTTHUMG00000023165
Pharos: Q9Y3A5(Tbio)
UniProt: Q9Y3A5 A0A0S2Z5I7
Structure
PDB: 

Position
7q11.21
AA seq 250 aa AA seqDB search
MSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNV
SKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCV
NPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPV
NEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLK
DVEEGDEKFE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcttcacccccaccaaccagatccgcctaaccaatgtggccgtggtacggatg
aagcgtgccgggaagcgcttcgaaatcgcctgctacaaaaacaaggtcgtcggctggcgg
agcggcgtggaaaaagacctcgatgaagttctgcagacccactcagtgtttgtaaatgtt
tctaaaggtcaggttgccaaaaaggaagatctcatcagtgcgtttggaacagatgaccaa
actgaaatctgtaagcagattttgactaaaggagaagttcaagtatcagataaagaaaga
cacacacaactggagcagatgtttagggacattgcaactattgtggcagacaaatgtgtg
aatcctgaaacaaagagaccatacaccgtgatccttattgagagagccatgaaggacatc
cactattcggtgaaaaccaacaagagtacaaaacagcaggctttggaagtgataaagcag
ttaaaagagaaaatgaagatagaacgtgctcacatgaggcttcggttcatccttccagtc
aatgaaggcaagaagctgaaagaaaagctcaagccactgatcaaggtcatagaaagtgaa
gattatggccaacagttagaaatcgtatgtctgattgacccgggctgcttccgagaaatt
gatgagctaataaaaaaggaaactaaaggcaaaggttctttggaagtactcaatctgaaa
gatgtagaagaaggagatgagaaatttgaatga

DBGET integrated database retrieval system