KEGG   Homo sapiens (human): 51121
Entry
51121             CDS       T01001                                 

Gene name
RPL26L1, RPL26P1
Definition
(RefSeq) ribosomal protein L26 like 1
  KO
K02898  large subunit ribosomal protein L26e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    51121 (RPL26L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    51121 (RPL26L1)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    51121 (RPL26L1)
SSDB
Motif
Pfam: Ribosomal_L26 KOW BLYB
Other DBs
NCBI-GeneID: 51121
NCBI-ProteinID: NP_001304909
HGNC: 17050
Ensembl: ENSG00000037241
Vega: OTTHUMG00000130517
Pharos: Q9UNX3(Tdark)
UniProt: Q9UNX3
Position
5q35.1
AA seq 145 aa
MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRG
HYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVITRLKLDKDRKKILE
RKAKSRQVGKEKGKYKEELIEKMQE
NT seq 438 nt   +upstreamnt  +downstreamnt
atgaagttcaatcccttcgttacctcggaccgcagtaaaaaccgcaaacgtcacttcaat
gccccctcacacgtgcgcaggaagatcatgtcatccccgctctccaaggagctgcggcag
aagtacaatgtccgctccatgcccatccgcaaggacgacgaggtccaggtagttcgagga
cactacaaaggtcagcaaattggcaaggtagtccaggtgtacagaaagaaatatgtcatc
tacatcgagcgggtgcagcgtgagaaggccaacggcacaactgtccacgtgggcattcac
ccaagcaaggtggttatcaccaggctaaaactggacaaggatcggaaaaaaattcttgaa
cgcaaagccaagtctcgacaagttggaaaagagaaaggcaaatataaagaagaacttatt
gagaaaatgcaggaataa

DBGET integrated database retrieval system