KEGG   Homo sapiens (human): 51122
Entry
51122             CDS       T01001                                 
Symbol
COMMD2, HSPC042
Name
(RefSeq) COMM domain containing 2
  KO
K22558  COMM domain containing 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51122 (COMMD2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Multi subunit type E3 associated proteins
    51122 (COMMD2)
SSDB
Motif
Pfam: COMM_domain
Other DBs
NCBI-GeneID: 51122
NCBI-ProteinID: NP_057178
OMIM: 616699
HGNC: 24993
Ensembl: ENSG00000114744
Pharos: Q86X83(Tdark)
UniProt: Q86X83
Position
3:complement(149738472..149752489)
AA seq 199 aa
MLLELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQH
GVEGLTYLLTESSKLMISELDFQDSVFVLGFSEELNKLLLQLYLDNRKEIRTILSELAPS
LPSYHNLEWRLDVQLASRSLRQQIKPAVTIKLHLNQNGDHNTKVLQTDPATLLHLVQQLE
QALEEMKTNHCRRVVRNIK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgctgctggaattgtccgaggagcataaggaacacctggccttcctgcctcaagtggac
agcgcggtggtcgccgagtttgggcggattgctgtggaattcctgagacgcggcgcaaac
ccaaaaatctacgaaggcgccgccagaaaactcaatgtgagtagtgacactgtccagcat
ggtgtggaaggattaacgtatctcctcactgagagctcaaagctcatgatttctgaactg
gatttccaagactctgtttttgttctgggattctctgaagaattaaacaaattgttgctt
cagctttatctggacaacagaaaagagatcagaacgattctgagtgaattggcaccaagc
cttcccagttatcataaccttgaatggcgactagatgtacagcttgcaagtagaagtctc
aggcaacagattaaaccagcagtgactataaagctacaccttaatcaaaatggagatcac
aacaccaaagttctgcagacagacccagccaccctgctccatttggttcaacaactggaa
caagcattggaagagatgaagacaaatcactgtaggagagttgttcgcaacatcaagtag

DBGET integrated database retrieval system