KEGG   Homo sapiens (human): 51125Help
Entry
51125             CDS       T01001                                 

Gene name
GOLGA7, GCP16, GOLGA3AP1, GOLGA7A, HSPC041
Definition
(RefSeq) golgin A7
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Erf4
Motif
Other DBs
NCBI-GeneID: 51125
NCBI-ProteinID: NP_001002296
OMIM: 609453
HGNC: 24876
Ensembl: ENSG00000147533
Vega: OTTHUMG00000164077
Pharos: Q7Z5G4(Tbio)
UniProt: Q7Z5G4
Position
8p11.21
AA seq 137 aa AA seqDB search
MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKL
GGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGL
RVIEITIYEDRGMSSGR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgcagcaggcgccggtgtccggaaaggtgttcattcagcgagactacagcagt
ggcacacgctgccagttccagaccaagttccctgcggagctggagaaccggattgatagg
cagcagtttgaagaaacagttcgaactctaaataacctttatgcagaagcagagaagctc
ggcggccagtcatatctcgaaggttgtttggcttgtttaacagcatataccatcttccta
tgcatggaaactcattatgagaaggttctgaagaaagtctccaaatacattcaagagcag
aatgagaagatctatgctccacaaggcctcctcctgacagaccctattgagcgaggactg
cgagttattgaaattaccatttatgaagacagaggcatgagcagtggaagataa

DBGET integrated database retrieval system