KEGG   Homo sapiens (human): 51127
Entry
51127             CDS       T01001                                 
Symbol
TRIM17, RBCC, RNF16, terf
Name
(RefSeq) tripartite motif containing 17
  KO
K12007  tripartite motif-containing protein 17 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51127 (TRIM17)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     51127 (TRIM17)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    51127 (TRIM17)
SSDB
Motif
Pfam: SPRY zf-RING_UBOX zf-C3HC4_4 zf-B_box zf-C3HC4 zf-C3HC4_2 zf-RING_2 zf-RING_5 zf-C3HC4_3 zf-Nse zf-RING_6 PRY CC149
Other DBs
NCBI-GeneID: 51127
NCBI-ProteinID: NP_001020111
OMIM: 606123
HGNC: 13430
Ensembl: ENSG00000162931
UniProt: Q9Y577
Position
1:complement(228407935..228416861)
AA seq 477 aa
MEAVELARKLQEEATCSICLDYFTDPVMTTCGHNFCRACIQLSWEKARGKKGRRKRKGSF
PCPECREMSPQRNLLPNRLLTKVAEMAQQHPGLQKQDLCQEHHEPLKLFCQKDQSPICVV
CRESREHRLHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEWQGKVKE
RRERIVLEFEKMNLYLVEEEQRLLQALETEEEETASRLRESVACLDRQGHSLELLLLQLE
ERSTQGPLQMLQDMKEPLSRKNNVSVQCPEVAPPTRPRTVCRVPGQIEVLRGFLEDVVPD
ATSAYPYLLLYESRQRRYLGSSPEGSGFCSKDRFVAYPCAVGQTAFSSGRHYWEVGMNIT
GDALWALGVCRDNVSRKDRVPKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGI
FLDFEAGEVSFYSVSDGSHLHTYSQATFPGPLQPFFCLGAPKSGQMVISTVTMWVKG
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggaggctgtggaactcgccagaaaactgcaggaggaagctacgtgctccatctgtctg
gattacttcacagaccctgtgatgaccacctgtggccacaacttctgccgagcctgcatc
cagctgagctgggaaaaggcgaggggcaagaaggggaggcggaagcggaagggctccttc
ccctgccccgagtgcagagagatgtccccgcagaggaacctgctgcccaaccggctgctg
accaaggtggccgagatggcgcagcagcatcctggtctgcagaagcaagacctgtgccag
gagcaccacgagcccctcaagcttttctgccagaaggaccagagccccatctgtgtggtg
tgcagggagtcccgggagcaccggctgcacagggtgctgcccgccgaggaggcagtgcag
gggtacaagttgaagctggaggaggacatggagtaccttcgggagcagatcaccaggaca
gggaatctgcaggccagggaggagcagagcttagccgagtggcagggcaaggtgaaggag
cggagagaacgcattgtgctggagtttgagaagatgaacctctacctggtggaagaagag
cagaggctcctccaggctctggagacggaagaagaggagactgccagcaggctccgggag
agcgtggcctgcctggaccggcagggtcactctctggagctgctgctgctgcagctggag
gagcggagcacacaggggcccctccagatgctgcaggacatgaaggaacccctgagcagg
aagaacaacgtgagtgtgcagtgcccagaggttgcccccccaaccagacccaggactgtg
tgcagagttcccggacagattgaagtgctaagaggctttctagaggatgtggtgcctgat
gccacctccgcgtacccctacctcctcctgtatgagagccgccagaggcgctacctcggc
tcttcgccggagggcagtgggttctgcagcaaggaccgatttgtggcttacccctgtgct
gtgggccagacggccttctcctctgggaggcactactgggaggtgggcatgaacatcacc
ggggacgcgttgtgggccctgggtgtgtgcagggacaacgtgagccggaaagacagggtc
cccaagtgccccgaaaacggcttctgggtggtgcagctgtccaaggggaccaagtactta
tccaccttctctgccctaaccccggtcatgctgatggagcctcccagccacatgggcatc
ttcctggacttcgaagccggggaagtgtccttctacagtgtaagcgatgggtcccacctg
cacacctactcccaggccaccttcccaggccccctgcagcctttcttctgcctgggggct
ccgaagtctggtcagatggtcatctccacagtgaccatgtgggtgaaaggatag

DBGET integrated database retrieval system