KEGG   Homo sapiens (human): 51128Help
Entry
51128             CDS       T01001                                 

Gene name
SAR1B, ANDD, CMRD, GTBPB, SARA2
Definition
(RefSeq) secretion associated Ras related GTPase 1B
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05134  Legionellosis
Module
hsa_M00404  COPII complex
Disease
H00927  Chylomicron retention disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51128 (SAR1B)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05134 Legionellosis
    51128 (SAR1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51128 (SAR1B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    51128 (SAR1B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     51128 (SAR1B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    51128 (SAR1B)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Sar
    51128 (SAR1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf G-alpha SRPRB Roc MMR_HSR1 Ras GTP_EFTU Metalloenzyme Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 51128
NCBI-ProteinID: NP_001028675
OMIM: 607690
HGNC: 10535
Ensembl: ENSG00000152700
Vega: OTTHUMG00000129114
Pharos: Q9Y6B6(Tbio)
UniProt: Q9Y6B6
Position
5q31.1
AA seq 198 aa AA seqDB search
MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPT
SEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMT
DETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSV
LKRQGYGEGFRWMAQYID
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcatatttgattggatttacagtggtttcagcagtgtgctacagtttttagga
ttatataagaaaactggtaaactggtatttcttggattggataatgcaggaaaaacaaca
ttgctacacatgctaaaagatgacagacttggacaacatgtcccaacattacatcccact
tccgaagaactgaccattgctggcatgacgtttacaacttttgatctgggtggacatgtt
caagctcgaagagtgtggaaaaactaccttcctgctatcaatggcattgtatttctggtg
gattgtgcagaccacgaaaggctgttagagtcaaaagaagaacttgattcactaatgaca
gatgaaaccattgctaatgtgcctatactgattcttgggaataagatcgacagacctgaa
gccatcagtgaagagaggttgcgagagatgtttggtttatatggtcagacaacaggaaag
gggagtatatctctgaaagaactgaatgcccgacccttagaagttttcatgtgtagtgtg
ctcaaaagacaaggttacggagaaggcttccgctggatggcacagtacattgattaa

DBGET integrated database retrieval system