KEGG   Homo sapiens (human): 51129Help
Entry
51129             CDS       T01001                                 

Gene name
ANGPTL4, ARP4, FIAF, HARP, HFARP, NL2, PGAR, TGQTL, UNQ171, pp1158
Definition
(RefSeq) angiopoietin like 4
  KO
K08767  angiopoietin-like 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03320  PPAR signaling pathway
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    51129 (ANGPTL4)
  09154 Digestive system
   04979 Cholesterol metabolism
    51129 (ANGPTL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    51129 (ANGPTL4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   51129 (ANGPTL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C SlyX Spc7 HeLo Atg14 DivIC Exonuc_VII_L Helo_like_N HemX
Motif
Other DBs
NCBI-GeneID: 51129
NCBI-ProteinID: NP_647475
OMIM: 605910
HGNC: 16039
Ensembl: ENSG00000167772
Vega: OTTHUMG00000182273
Pharos: Q9BY76(Tbio)
UniProt: Q9BY76
Structure
PDB: 

Position
19p13.2
AA seq 406 aa AA seqDB search
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAE
RTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLF
HKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSR
LHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRP
WEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAY
SLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLN
GQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtgctccgacggccggggcagccctgatgctctgcgccgccaccgccgtgcta
ctgagcgctcagggcggacccgtgcagtccaagtcgccgcgctttgcgtcctgggacgag
atgaatgtcctggcgcacggactcctgcagctcggccaggggctgcgcgaacacgcggag
cgcacccgcagtcagctgagcgcgctggagcggcgcctgagcgcgtgcgggtccgcctgt
cagggaaccgaggggtccaccgacctcccgttagcccctgagagccgggtggaccctgag
gtccttcacagcctgcagacacaactcaaggctcagaacagcaggatccagcaactcttc
cacaaggtggcccagcagcagcggcacctggagaagcagcacctgcgaattcagcatctg
caaagccagtttggcctcctggaccacaagcacctagaccatgaggtggccaagcctgcc
cgaagaaagaggctgcccgagatggcccagccagttgacccggctcacaatgtcagccgc
ctgcaccggctgcccagggattgccaggagctgttccaggttggggagaggcagagtgga
ctatttgaaatccagcctcaggggtctccgccatttttggtgaactgcaagatgacctca
gatggaggctggacagtaattcagaggcgccacgatggctcagtggacttcaaccggccc
tgggaagcctacaaggcggggtttggggatccccacggcgagttctggctgggtctggag
aaggtgcatagcatcacgggggaccgcaacagccgcctggccgtgcagctgcgggactgg
gatggcaacgccgagttgctgcagttctccgtgcacctgggtggcgaggacacggcctat
agcctgcagctcactgcacccgtggccggccagctgggcgccaccaccgtcccacccagc
ggcctctccgtacccttctccacttgggaccaggatcacgacctccgcagggacaagaac
tgcgccaagagcctctctggaggctggtggtttggcacctgcagccattccaacctcaac
ggccagtacttccgctccatcccacagcagcggcagaagcttaagaagggaatcttctgg
aagacctggcggggccgctactacccgctgcaggccaccaccatgttgatccagcccatg
gcagcagaggcagcctcctag

DBGET integrated database retrieval system