KEGG   Homo sapiens (human): 51131Help
Entry
51131             CDS       T01001                                 

Gene name
PHF11, APY, BCAP, IGEL, IGER, IGHER, NY-REN-34, NYREN34
Definition
(RefSeq) PHD finger protein 11
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2 PHD DUF3416
Motif
Other DBs
NCBI-GeneID: 51131
NCBI-ProteinID: NP_001035533
OMIM: 607796
HGNC: 17024
Ensembl: ENSG00000136147
Vega: OTTHUMG00000016916
Pharos: Q9UIL8(Tbio)
UniProt: Q9UIL8 B4DDL5
Position
13q14.2
AA seq 331 aa AA seqDB search
MAQASPPRPERVLGASSPEARPAQEALLLPTGVFQVAEKMEKRTCALCPKDVEYNVLYFA
QSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATV
GCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGR
KKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDK
VHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEI
ELLQDLKQTLCSFQENRDLMSSSTSISSLSY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcgtcgccgccccggcccgagagggtgctcggcgccagcagcccggaggcc
cggcccgcgcaggaggcgctcctccttcccaccggtgtctttcaggttgcagaaaagatg
gaaaaaaggacatgtgcactctgccccaaagatgtcgaatataatgtcctatactttgca
caatcagagaatatagctgctcatgagaattgtttgctgtattcttcaggacttgtggaa
tgtgaggatcaggatccacttaatcctgatagaagttttgatgtggaatcagtaaagaaa
gaaatccagagaggaaggaagttgaaatgcaaattttgtcataaaagaggagccaccgtg
ggatgtgatttaaaaaactgtaacaagaattaccactttttctgtgccaagaaggacgac
gcagttccacagtctgatggagttcgaggaatttataaactgctttgccagcaacatgct
caattcccgatcatcgctcaaagtgctaaattttcaggagtgaaaagaaaaagaggaagg
aagaaacccctctcaggcaatcatgtacagccacccgaaacaatgaaatgtaatacattc
ataagacaagtgaaagaagagcatggcagacacacagatgcaactgtgaaagttcctttt
cttaagaaatgcaaggaagcaggacttcttaattacttacttgaagaaatattagacaaa
gttcattcaattccagaaaaactcatggatgagactacttcagaatcagactatgaagaa
atcgggagtgcactttttgactgtagattgttcgaagacacatttgtaaattttcaagca
gcaatagagaaaaaaattcatgcatctcaacaaaggtggcagcagttgaaggaagagatt
gagctacttcaggacttaaaacaaaccttgtgctcttttcaagaaaatagagatcttatg
tcaagttctacatcaatatcatccctgtcttattag

DBGET integrated database retrieval system