KEGG   Homo sapiens (human): 51138Help
Entry
51138             CDS       T01001                                 

Gene name
COPS4, CSN4, SGN4
Definition
(RefSeq) COP9 signalosome subunit 4
  KO
K12178  COP9 signalosome complex subunit 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51138 (COPS4)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   COP9 signalosome (CSN) complex
    51138 (COPS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSN4_RPN5_eIF3a PCI RPN7 TPR_12
Motif
Other DBs
NCBI-GeneID: 51138
NCBI-ProteinID: NP_057213
OMIM: 616008
HGNC: 16702
Ensembl: ENSG00000138663
Vega: OTTHUMG00000130298
Pharos: Q9BT78(Tbio)
UniProt: Q9BT78 A0A0S2Z5H7 B3KM48
Structure
PDB: 

Position
4q21.22
AA seq 406 aa AA seqDB search
MAAAVRQDLAQLMNSSGSHKDLAGKYRQILEKAIQLSGAEQLEALKAFVEAMVNENVSLV
ISRQLLTDFCTHLPNLPDSTAKEIYHFTLEKIQPRVISFEEQVASIRQHLASIYEKEEDW
RNAAQVLVGIPLETGQKQYNVDYKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTN
EQLQIHYKVCYARVLDYRRKFIEAAQRYNELSYKTIVHESERLEALKHALHCTILASAGQ
QRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSIL
DRAVIEHNLLSASKLYNNITFEELGALLEIPAAKAEKIASQMITEGRMNGFIDQIDGIVH
FETREALPTWDKQIQSLCFQVNNLLEKISQTAPEWTAQAMEAQMAQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagccgtgcgacaggatttggcccagctcatgaattcgagcggctctcataaa
gatctggctggcaagtatcgtcagatcctggaaaaagccattcagttatctggagcagaa
caactagaagctttgaaagcttttgtggaagcaatggtaaatgagaatgtcagtctcgtg
atctcgcggcagttgctgactgatttttgcacacatcttcctaacttgcctgatagcaca
gccaaagaaatctatcacttcaccttggaaaagatccagcctagagtcatttcatttgag
gagcaggttgcttccataagacagcatcttgcatctatatatgagaaagaagaagattgg
agaaatgcagcccaagtgttggtgggaattcctttggaaacaggacaaaaacagtacaat
gtagattataaactggagacttacttgaagattgctaggctatatctggaggatgatgat
ccagtccaggcagaggcttacataaatcgagcatcgttgcttcagaatgaatcaaccaat
gaacaattacagatacattataaggtatgctatgcacgtgttcttgattatagaagaaaa
ttcattgaagctgcacaaaggtacaatgagctctcttacaagacaatagtccacgaaagt
gaaagactagaggccttaaaacatgctttgcactgtacgatcttagcatcagcagggcag
cagcgttctcggatgctagctactctttttaaggatgaaaggtgccagcaacttgctgcc
tatgggatcctagagaaaatgtatctagataggatcatcagaggaaatcaacttcaagaa
tttgctgccatgctgatgcctcaccaaaaagcaactacagctgatggttccagcatcttg
gacagagctgttattgaacacaatttgttgtctgcaagcaaattatataataatattacc
ttcgaagaacttggagctcttttagagatccctgcagctaaggcggaaaagatagcatct
caaatgataaccgaaggacgtatgaatggatttattgaccagattgatggaatagttcat
tttgaaacacgagaagccctgccaacgtgggataagcagatccaatcactttgtttccaa
gtgaataaccttttggagaaaattagtcaaacagcaccagaatggacagcacaagccatg
gaagcccagatggctcagtga

DBGET integrated database retrieval system