KEGG   Homo sapiens (human): 51142
Entry
51142             CDS       T01001                                 
Symbol
CHCHD2, C7orf17, MIX17B, MNRR1, NS2TP, PARK22
Name
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 2
  KO
K22758  coiled-coil-helix-coiled-coil-helix domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Disease
H00057  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    51142 (CHCHD2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Other transcription factors
   Others
    51142 (CHCHD2)
SSDB
Motif
Pfam: CHCH
Other DBs
NCBI-GeneID: 51142
NCBI-ProteinID: NP_057223
OMIM: 616244
HGNC: 21645
Ensembl: ENSG00000106153
Pharos: Q9Y6H1(Tbio)
UniProt: Q9Y6H1
Position
7:complement(56101573..56106476)
AA seq 151 aa
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMA
TTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQ
FLECAQNQGDIKLCEGFNEVLKQCRLANGLA
NT seq 456 nt   +upstreamnt  +downstreamnt
atgccgcgtggaagccgaagccgcacctcccgcatggcccctccggccagccgggcccct
cagatgagagctgcacccaggccagcaccagtcgctcagccaccagcagcggcaccccca
tctgcagttggctcttctgctgctgcgccccggcagccaggtctgatggcccagatggca
accactgcagctggcgtggctgtgggctctgctgtggggcacacattgggtcacgccatt
actgggggcttcagtggaggaagtaatgctgagcctgcgaggcctgacatcacttaccag
gagcctcagggaacccagccagcacagcagcagcagccttgcctctatgagatcaaacag
tttctggagtgtgcccagaaccagggtgacatcaagctctgtgagggtttcaatgaggtg
ctgaaacagtgccgacttgcaaacggattggcctaa

DBGET integrated database retrieval system