KEGG   Homo sapiens (human): 51143Help
Entry
51143             CDS       T01001                                 

Gene name
DYNC1LI1, DLC-A, DNCLI1, LIC1
Definition
(RefSeq) dynein cytoplasmic 1 light intermediate chain 1
  KO
K10416  dynein light intermediate chain 1, cytosolic
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04962  Vasopressin-regulated water reabsorption
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    51143 (DYNC1LI1)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    51143 (DYNC1LI1)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    51143 (DYNC1LI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51143 (DYNC1LI1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    51143 (DYNC1LI1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    51143 (DYNC1LI1)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    51143 (DYNC1LI1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     Dynein complex
      51143 (DYNC1LI1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     51143 (DYNC1LI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DLIC ABC_tran Roc RsgA_GTPase AAA_16 PduV-EutP DUF815 G-alpha TsaE AAA_7
Motif
Other DBs
NCBI-GeneID: 51143
NCBI-ProteinID: NP_057225
OMIM: 615890
HGNC: 18745
Ensembl: ENSG00000144635
Vega: OTTHUMG00000130750
Pharos: Q9Y6G9(Tbio)
UniProt: Q9Y6G9
Structure
PDB: 

Position
3p22.3
AA seq 523 aa AA seqDB search
MAAVGRVGSFGSSPPGLSSTYTGGPLGNEIASGNGGAAAGDDEDGQNLWSCILSEVSTRS
RSKLPAGKNVLLLGEDGAGKTSLIRKIQGIEEYKKGRGLEYLYLNVHDEDRDDQTRCNVW
ILDGDLYHKGLLKFSLDAVSLKDTLVMLVVDMSKPWTALDSLQKWASVVREHVDKLKIPP
EEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLTHNLGIPV
LVVCTKCDAISVLEKEHDYRDEHFDFIQSHIRKFCLQYGAALIYTSVKENKNIDLVYKYI
VQKLYGFPYKIPAVVVEKDAVFIPAGWDNDKKIGILHENFQTLKAEDNFEDIITKPPVRK
FVHEKEIMAEDDQVFLMKLQSLLAKQPPTAAGRPVDASPRVPGGSPRTPNRSVSSNVASV
SPIPAGSKKIDPNMKAGATSEGVLANFFNSLLSKKTGSPGGPGVSGGSPAGGAGGGSSGL
PPSTKKSGQKPVLDVHAELDRITRKPVTVSPTTPTSPTEGEAS
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtggggcgagtcggctccttcggttcttctccgccgggattatcctcgact
tacactggcggccccttgggcaacgagatagcgtcgggcaacggtggcgccgcggcaggc
gacgacgaggacgggcagaacctttggtcctgcatcctcagcgaggtctccacccgctcg
cgctccaagctccctgcggggaagaacgtgctactgctgggtgaagatggagctggaaaa
acaagcttaataagaaaaattcagggaatagaggagtataagaaaggaagaggattggaa
tatttgtacttaaatgtgcatgatgaagacagggatgatcaaacaagatgtaatgtttgg
atcttagatggagacctatatcacaaaggcctccttaaattttcactggatgccgtatct
ctgaaggatactctagttatgctggttgttgacatgtcaaagccttggactgctttggat
tctttacagaaatgggcaagtgttgttagagaacatgttgacaaactgaaaatccctcct
gaagaaatgaaacaaatggaacaaaagttgattagagacttccaagaatatgtagagcca
ggagaagacttcccggcttctccccagagaagaaatactgcgtcacaagaagacaaagat
gacagtgtagttttacctctgggtgcggatacacttacacataacttgggcattccagta
ctagtagtttgcacaaagtgtgatgccattagtgtattggagaaagaacatgactacaga
gatgaacattttgattttattcagtcacatatccggaagttttgtttacagtatggtgca
gcacttatttacacttcagtaaaagaaaacaaaaatatagacttagtatataaatacatc
gttcagaaactatatggatttccctataagattcctgctgttgttgtggaaaaggatgca
gtatttattccagcagggtgggataatgataagaaaataggaatattacatgaaaatttt
caaacattaaaagcagaagataattttgaagacatcataactaaaccacctgttcgaaag
tttgtacatgagaaggaaattatggcagaagatgatcaggtgtttcttatgaagctacag
tcccttttagcaaagcaaccaccaactgcagctggaaggcctgtggatgcctcaccaaga
gtcccaggaggctccccacgaacaccaaatagatctgtatcatctaatgttgccagcgtg
tcacccattcctgctgggtcaaaaaaaattgatccaaacatgaaagctggagctacaagt
gaaggcgttctggcaaatttcttcaacagtttgttgagtaaaaagactggctctccagga
ggccctggtgtgagtggtggtagccctgcaggtggggctggaggtggaagcagtggttta
ccaccatccaccaaaaagtcaggccagaagcctgtcttagatgttcatgcagaactagac
agaattacacgaaaaccagttacagtttctcccacaacacctacatctcctacggaagga
gaagcttcttga

DBGET integrated database retrieval system