KEGG   Homo sapiens (human): 51144
Entry
51144             CDS       T01001                                 

Gene name
HSD17B12, KAR, SDR12C1
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 12
  KO
K10251  17beta-estradiol 17-dehydrogenase / very-long-chain 3-oxoacyl-CoA reductase [EC:1.1.1.62 1.1.1.330]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00062  Fatty acid elongation
hsa00140  Steroid hormone biosynthesis
hsa01040  Biosynthesis of unsaturated fatty acids
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    51144 (HSD17B12)
   00140 Steroid hormone biosynthesis
    51144 (HSD17B12)
   01040 Biosynthesis of unsaturated fatty acids
    51144 (HSD17B12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    51144 (HSD17B12)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     51144 (HSD17B12)
    1.1.1.330  very-long-chain 3-oxoacyl-CoA reductase
     51144 (HSD17B12)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   51144 (HSD17B12)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Sacchrp_dh_NADP Polysacc_synt_2 3HCDH_N TrkA_N ApbA Epimerase NAD_binding_10
Other DBs
NCBI-GeneID: 51144
NCBI-ProteinID: NP_057226
OMIM: 609574
HGNC: 18646
Ensembl: ENSG00000149084
Vega: OTTHUMG00000166403
Pharos: Q53GQ0(Tbio)
UniProt: Q53GQ0
Position
11p11.2
AA seq 312 aa
MESALPAAGFLYWVGAGTVAYLALRISYSLFTALRVWGVGNEAGVGPGLGEWAVVTGSTD
GIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKT
GLAGLEIGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPGMVERS
KGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLA
KIRKPTLDKPSPETFVKSAIKTVGLQSRTNGYLIHALMGSIISNLPSWIYLKIVMNMNKS
TRAHYLKKTKKN
NT seq 939 nt   +upstreamnt  +downstreamnt
atggagagcgctctccccgccgccggcttcctgtactgggtcggcgcgggcaccgtggcc
tacctagccctgcgtatttcgtactcgctcttcacggccctccgggtctggggagtgggg
aatgaggcgggggtcggcccggggctcggagaatgggcagttgtcacaggtagtactgat
ggaattggaaaatcatatgcagaagagttagcaaagcatggaatgaaggttgtccttatc
agcagatcaaaggataaacttgaccaggtttccagtgaaataaaagaaaaattcaaagtg
gagacaagaaccattgctgttgactttgcatcagaagatatttatgataaaattaaaaca
ggcttggctggtcttgaaatcggcatcttagtgaacaacgtgggaatgtcgtatgagtat
cctgaatactttttggatgttcctgacttggacaatgtgatcaagaaaatgataaatatt
aatattctttctgtttgtaagatgacacaattggtactgcctggcatggtggaaagatcc
aaaggggctattctgaacatttcatctggcagtggcatgctccctgtcccactcttgacc
atctattctgcaaccaagacttttgtagatttcttctctcagtgcctccatgaggagtat
aggagcaagggcgtctttgtgcagagtgtcctgccatacttcgtagctacaaaactggct
aaaatccggaagccaactttggataagccctctccggagacgtttgtgaagtctgcaatt
aaaacagtcggcctgcaatcccgaaccaatggatacctgatccatgctcttatgggctcg
ataatctcaaacctgccttcttggatttatttgaaaatagtcatgaatatgaacaagtct
acacgggctcactatctgaagaaaaccaagaagaactaa

DBGET integrated database retrieval system