KEGG   Homo sapiens (human): 51146
Entry
51146             CDS       T01001                                 

Gene name
A4GNT, alpha4GnT
Definition
(RefSeq) alpha-1,4-N-acetylglucosaminyltransferase
  KO
K08251  alpha 1,4-N-acetylglucosaminyltransferase [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    51146 (A4GNT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     51146 (A4GNT)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   51146 (A4GNT)
SSDB
Motif
Pfam: Gb3_synth Gly_transf_sug TcdA_TcdB
Other DBs
NCBI-GeneID: 51146
NCBI-ProteinID: NP_057245
OMIM: 616709
HGNC: 17968
Ensembl: ENSG00000118017
Vega: OTTHUMG00000159820
Pharos: Q9UNA3(Tbio)
UniProt: Q9UNA3
Position
3q22.3
AA seq 340 aa
MRKELQLSLSVTLLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSER
MEPPHLVSCSVESAAKIYPEWPVVFFMKGLTDSTPMPSNSTYPAFSFLSAIDNVFLFPLD
MKRLLEDTPLFSWYNQINASAERNWLHISSDASRLAIIWKYGGIYMDTDVISIRPIPEEN
FLAAQASRYSSNGIFGFLPHHPFLWECMENFVEHYNSAIWGNQGPELMTRMLRVWCKLED
FQEVSDLRCLNISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
IRGSNTLVENLYRKHCPRTYRDLIKGPEGSVTGELGPGNK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcggaaggagctccagctctccctgtcagtcaccttgctgcttgtctgtggcttcctc
taccagttcaccctgaagtccagctgcctcttctgtttgccttctttcaagtcccaccag
gggctggaagccctcctgagccacagacgtggcattgtgtttctagagacctcagagaga
atggagccaccccatttggtctcctgttccgtagagtctgctgccaagatttatcctgag
tggcctgtggtgttctttatgaagggtcttactgattccacaccgatgccctcaaactcc
acatacccagctttttccttcctgtcagcaatagacaacgttttcctcttccctttggat
atgaaaaggctgcttgaagacacaccattgttttcatggtacaatcaaatcaacgccagc
gcagagagaaactggctccacatcagctcggatgcatcccgcctggccatcatctggaaa
tacggtggcatctacatggacaccgatgtcatctccatcaggcccatccctgaggagaac
tttttggctgcgcaggcttctcggtactctagtaatggaatatttgggttcctcccccac
cacccctttttgtgggaatgcatggaaaactttgttgaacactataattcagccatttgg
ggcaaccaaggccctgagttgatgacaaggatgttgagggtatggtgtaaacttgaagac
ttccaggaggtgagcgacctcaggtgtctgaacatatccttcttacacccccaaagattt
taccccatctcctatcgagagtggaggcgctactatgaagtgtgggatacagagccaagc
ttcaatgtctcttatgccctgcatttgtggaaccacatgaaccaggaggggcgggctgtg
attagaggaagcaacacactggtggaaaatctctatcgcaagcactgtcccaggacttac
agggacctgattaaaggcccagaggggtcagtgactggggagctgggtccaggtaacaaa
taa

DBGET integrated database retrieval system