KEGG   Homo sapiens (human): 51148
Entry
51148             CDS       T01001                                 
Symbol
CERCAM, CEECAM1, GLT25D3
Name
(RefSeq) cerebral endothelial cell adhesion molecule
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Other DBs
NCBI-GeneID: 51148
NCBI-ProteinID: NP_057258
OMIM: 616626
HGNC: 23723
Ensembl: ENSG00000167123
Pharos: Q5T4B2(Tdark)
UniProt: Q5T4B2
Position
9:128419160..128437351
AA seq 595 aa
MRAARAAPLLQLLLLLGPWLEAAGVAESPLPAVVLAILARNAEHSLPHYLGALERLDYPR
ARMALWCATDHNVDNTTEMLQEWLAAVGDDYAAVVWRPEGEPRFYPDEEGPKHWTKERHQ
FLMELKQEALTFARNWGADYILFADTDNILTNNQTLRLLMGQGLPVVAPMLDSQTYYSNF
WCGITPQGYYRRTAEYFPTKNRQRRGCFRVPMVHSTFLASLRAEGADQLAFYPPHPNYTW
PFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDGPR
MQASAHVTRPSKRPSKIGFDEVFVISLARRPDRRERMLASLWEMEISGRVVDAVDGWMLN
SSAIRNLGVDLLPGYQDPYSGRTLTKGEVGCFLSHYSIWEEVVARGLARVLVFEDDVRFE
SNFRGRLERLMEDVEAEKLSWDLIYLGRKQVNPEKETAVEGLPGLVVAGYSYWTLAYALR
LAGARKLLASQPLRRMLPVDEFLPIMFDQHPNEQYKAHFWPRDLVAFSAQPLLAAPTHYA
GDAEWLSDTETSSPWDDDSGRLISWSGSQKTLRSPRLDLTGSSGHSLQPQPRDEL
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcgcgctgcccgcgccgcgccgctgctccagctgctgctcctgctggggccgtggctg
gaggctgcgggcgttgcggagtcgccgctgcccgccgtggtccttgccatcctggcccgc
aatgccgaacactcgctgccccactacctgggcgctctggagcggctggactacccccgg
gccaggatggccctctggtgtgccacggaccacaatgtggacaacaccacagagatgctg
caggagtggctggcggctgtgggcgatgactatgctgctgtggtctggaggcctgagggc
gagcccaggttctacccagatgaagagggtcccaagcactggaccaaagaaaggcaccag
tttctgatggagctgaagcaggaagccctcacctttgccaggaactggggggccgactat
atcctgtttgcagacacagacaacattctgaccaacaatcagactctgcggcttctcatg
gggcaggggcttccagtggtggccccaatgctggactcccagacctactactccaacttc
tggtgtgggatcaccccccagggctactaccgccgcacagccgagtacttccccaccaag
aaccgccagcgccggggctgcttccgtgtccccatggtccactccaccttccttgcatcc
ctgcgggctgaaggggcagaccagcttgctttctacccgccacatcccaactacacttgg
cctttcgacgacatcatcgtcttcgcctatgcctgccaggctgctggggtctccgtccac
gtgtgcaatgagcaccgttatgggtacatgaatgtgccggtgaaatcccaccaggggctg
gaagacgagagggtcaacttcatccacctgatcttagaagcactagtggacggcccccgc
atgcaggcctcagctcatgtgactcggccctctaagaggcccagcaagatagggtttgac
gaggtctttgtcatcagcctggctcgcaggcctgaccgtcgggaacgcatgctcgcctcg
ctctgggagatggagatctctgggagggtggtggacgctgtggatggctggatgctcaac
agcagtgccatcaggaacctcggcgtagacctgctcccgggctaccaggacccttactcg
ggccgcactctgaccaagggcgaggtgggctgcttcctcagccattactccatctgggaa
gaggtggttgccaggggcctggcccgggtcctggtgtttgaggatgacgtgcgctttgag
agcaacttcagggggcggctggagcggctgatggaggatgtggaggcagagaaactgtct
tgggacctgatctacctcggacggaagcaggtgaaccctgagaaggagacggccgtggag
gggctgccgggcctggtggtggctgggtactcctactggacgctggcctatgccctgcgt
ctggcgggtgcccgcaagctgctggcctcacagcctctgcgccgcatgctgcccgtggac
gagttcctgcccatcatgttcgaccagcaccccaacgagcagtacaaggcacacttctgg
ccacgggacctggtggccttctccgcccagcccctgctcgctgcccctacccactatgcc
ggggacgccgagtggctcagtgacacggagacatcctctccatgggatgatgacagcggc
cgcctcatcagctggagcggctcccaaaagaccctgcgcagcccccgcctggacctgact
ggcagcagcgggcacagcctccaaccccagccccgagatgagctctag

DBGET integrated database retrieval system