KEGG   Homo sapiens (human): 51150
Entry
51150             CDS       T01001                                 

Gene name
SDF4, Cab45, SDF-4
Definition
(RefSeq) stromal cell derived factor 4
  KO
K19934  calcium-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51150 (SDF4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    51150 (SDF4)
 Endoplasmic reticulum (ER) - Golgi transport
  Others
    51150 (SDF4)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg Pex14_N DUF5663
Other DBs
NCBI-GeneID: 51150
NCBI-ProteinID: NP_057260
OMIM: 614282
HGNC: 24188
Ensembl: ENSG00000078808
Vega: OTTHUMG00000001812
Pharos: Q9BRK5(Tbio)
UniProt: Q9BRK5 A0A024R084
Position
1p36.33
AA seq 355 aa
MASRWGPLIGLAPCCLWLLGAVLLMDASARPANHSSTRERVANREENEILPPDHLNGVKL
EMDGHLNRGFHQEVFLGKDLGGFDEDAEPRRSRRKLMVIFSKVDVNTDRKISAKEMQRWI
MEKTAEHFQEAMEESKTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEEL
KVDEETQEVLENLKDRWYQADSPPADLLLTEEEFLSFLHPEHSRGMLRFMVKEIVRDLDQ
DGDKQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTAEELESYM
DPMNEYNALNEAKQMIAVADENQNHHLEPEEVLKYSEFFTGSKLVDYARSVHEEF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggcgtccaggtggggtcccctcattggcctggctccgtgctgcctctggctcctgggg
gcagtccttctgatggacgcgtctgcacggcctgccaaccactcgtccactcgagagaga
gtagccaacagggaggagaatgagatcctgcccccagaccacctgaacggggtgaagctg
gagatggacgggcacctcaatcgcggcttccaccaggaggtcttcctaggcaaggacctg
ggtggctttgatgaggacgcggagccgcggcggagccggaggaagctgatggtcatcttt
tccaaggtggatgtgaacactgaccggaagatcagtgccaaggagatgcagcgctggatc
atggagaagacggccgagcacttccaggaggccatggaggagagcaagacacacttccgc
gccgtggaccctgacggggacggtcacgtgtcttgggacgagtataaggtgaagtttttg
gcgagtaaaggccatagcgagaaggaggttgccgacgccatcaggctcaacgaggaactc
aaagtggatgaggaaacacaggaagtcctggagaacctgaaggaccgctggtaccaggcg
gacagcccccctgcagacctgctgctgacggaggaggagttcctgtcgttcctccacccc
gagcacagccggggaatgctcaggttcatggtgaaggagatcgtccgggacctggaccag
gacggtgacaagcagctctctgtgcccgagttcatctccctgcccgtgggcaccgtggag
aaccagcagggccaggacattgacgacaactgggtgaaagacagaaaaaaggagtttgag
gagctcattgactccaaccacgacggcatcgtgaccgccgaggagctggagagctacatg
gaccccatgaacgagtacaacgcgctgaacgaggccaagcagatgatcgccgtcgccgac
gagaaccagaaccaccacctggagcccgaggaggtgctcaagtacagcgagttcttcacg
ggcagcaagctggtggactacgcgcgcagcgtgcacgaggagttttga

DBGET integrated database retrieval system