KEGG   Homo sapiens (human): 5116
Entry
5116              CDS       T01001                                 

Gene name
PCNT, KEN, MOPD2, PCN, PCNT2, PCNTB, PCTN2, SCKL4
Definition
(RefSeq) pericentrin
  KO
K16481  pericentrin
Organism
hsa  Homo sapiens (human)
Disease
H00991  Microcephalic osteodysplastic primordial dwarfism, type II (MOPD II)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    5116 (PCNT)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    5116 (PCNT)
SSDB
Motif
Pfam: PACT_coil_coil Atg14
Other DBs
NCBI-GeneID: 5116
NCBI-ProteinID: NP_006022
OMIM: 605925
HGNC: 16068
Ensembl: ENSG00000160299
Vega: OTTHUMG00000090665
Pharos: O95613(Tbio)
UniProt: O95613
Position
21q22.3
AA seq 3336 aa
MEVEQEQRRRKVEAGRTKLAHFRQRKTKGDSSHSEKKTAKRKGSAVDASVQEESPVTKED
SALCGGGDICKSTSCDDTPDGAGGAFAAQPEDCDGEKREDLEQLQQKQVNDHPPEQCGMF
TVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPE
QRGMFTVSDHTPEQRGIFTISDHPAEQRGMFTKECEQECELAITDLESGREDEAGLHQSQ
AVHGLELEALRLSLSNMHTAQLELTQANLQKEKETALTELREMLNSRRAQELALLQSRQQ
HELELLREQHAREKEEVVLRCGQEAAELKEKLQSEMEKNAQIVKTLKEDWESEKDLCLEN
LRKELSAKHQSEMEDLQNQFQKELAEQRAELEKIFQDKNQAERALRNLESHHQAAIEKLR
EDLQSEHGRCLEDLEFKFKESEKEKQLELENLQASYEDLKAQSQEEIRRLWSQLDSARTS
RQELSELHEQLLARTSRVEDLEQLKQREKTQHESELEQLRIYFEKKLRDAEKTYQEDLTL
LQQRLQGAREDALLDSVEVGLSCVGLEEKPEKGRKDHVDELEPERHKESLPRFQAELEES
HRHQLEALESPLCIQHEGHVSDRCCVETSALGHEWRLEPSEGHSQELPWVHLQGVQDGDL
EADTERAARVLGLETEHKVQLSLLQTELKEEIELLKIENRNLYGKLQHETRLKDDLEKVK
HNLIEDHQKELNNAKQKTELMKQEFQRKETDWKVMKEELQREAEEKLTLMLLELREKAES
EKQTIINKFELREAEMRQLQDQQAAQILDLERSLTEQQGRLQQLEQDLTSDDALHCSQCG
REPPTAQDGELAALHVKEDCALQLMLARSRFLEERKEITEKFSAEQDAFLQEAQEQHARE
LQLLQERHQQQLLSVTAELEARHQAALGELTASLESKQGALLAARVAELQTKHAADLGAL
ETRHLSSLDSLESCYLSEFQTIREEHRQALELLRADFEEQLWKKDSLHQTILTQELEKLK
RKHEGELQSVRDHLRTEVSTELAGTVAHELQGVHQGEFGSEKKTALHEKEETLRLQSAQA
QPFHQEEKESLSLQLQKKNHQVQQLKDQVLSLSHEIEECRSELEVLQQRRERENREGANL
LSMLKADVNLSHSERGALQDALRRLLGLFGETLRAAVTLRSRIGERVGLCLDDAGAGLAL
STAPALEETWSDVALPELDRTLSECAEMSSVAEISSHMRESFLMSPESVRECEQPIRRVF
QSLSLAVDGLMEMALDSSRQLEEARQIHSRFEKEFSFKNEETAQVVRKHQELLECLKEES
AAKAELALELHKTQGTLEGFKVETADLKEVLAGKEDSEHRLVLELESLRRQLQQAAQEQA
ALREECTRLWSRGEATATDAEAREAALRKEVEDLTKEQSETRKQAEKDRSALLSQMKILE
SELEEQLSQHRGCAKQAEAVTALEQQVASLDKHLRNQRQFMDEQAAEREHEREEFQQEIQ
RLEGQLRQAAKPQPWGPRDSQQAPLDGEVELLQQKLREKLDEFNELAIQKESADRQVLMQ
EEEIKRLEEMNINIRKKVAQLQEEVEKQKNIVKGLEQDKEVLKKQQMSSLLLASTLQSTL
DAGRCPEPPSGSPPEGPEIQLEVTQRALLRRESEVLDLKEQLEKMKGDLESKNEEILHLN
LKLDMQNSQTAVSLRELEEENTSLKVIYTRSSEIEELKATIENLQENQKRLQKEKAEEIE
QLHEVIEKLQHELSLMGPVVHEVSDSQAGSLQSELLCSQAGGPRGQALQGELEAALEAKE
ALSRLLADQERRHSQALEALQQRLQGAEEAAELQLAELERNVALREAEVEDMASRIQEFE
AALKAKEATIAERNLEIDALNQRKAAHSAELEAVLLALARIRRALEQQPLAAGAAPPELQ
WLRAQCARLSRQLQVLHQRFLRCQVELDRRQARRATAHTRVPGAHPQPRMDGGAKAQVTG
DVEASHDAALEPVVPDPQGDLQPVLVTLKDAPLCKQEGVMSVLTVCQRQLQSELLLVKNE
MRLSLEDGGKGKEKVLEDCQLPKVDLVAQVKQLQEKLNRLLYSMTFQNVDAADTKSLWPM
ASAHLLESSWSDDSCDGEEPDISPHIDTCDANTATGGVTDVIKNQAIDACDANTTPGGVT
DVIKNWDSLIPDEMPDSPIQEKSECQDMSLSSPTSVLGGSRHQSHTAEAGPRKSPVGMLD
LSSWSSPEVLRKDWTLEPWPSLPVTPHSGALSLCSADTSLGDRADTSLPQTQGPGLLCSP
GVSAAALALQWAESPPADDHHVQRTAVEKDVEDFITTSFDSQETLSSPPPGLEGKADRSE
KSDGSGFGARLSPGSGGPEAQTAGPVTPASISGRFQPLPEAMKEKEVRPKHVKALLQMVR
DESHQILALSEGLAPPSGEPHPPRKEDEIQDISLHGGKTQEVPTACPDWRGDLLQVVQEA
FEKEQEMQGVELQPRLSGSDLGGHSSLLERLEKIIREQGDLQEKSLEHLRLPDRSSLLSE
IQALRAQLRMTHLQNQEKLQHLRTALTSAEARGSQQEHQLRRQVELLAYKVEQEKCIAGD
LQKTLSEEQEKANSVQKLLAAEQTVVRDLKSDLCESRQKSEQLSRSLCEVQQEVLQLRSM
LSSKENELKAALQELESEQGKGRALQSQLEEEQLRHLQRESQSAKALEELRASLETQRAQ
SSRLCVALKHEQTAKDNLQKELRIEHSRCEALLAQERSQLSELQKDLAAEKSRTLELSEA
LRHERLLTEQLSQRTQEACVHQDTQAHHALLQKLKEEKSRVVDLQAMLEKVQQQALHSQQ
QLEAEAQKHCEALRREKEVSATLKSTVEALHTQKRELRCSLEREREKPAWLQAELEQSHP
RLKEQEGRKAARRSAEARQSPAAAEQWRKWQRDKEKLRELELQRQRDLHKIKQLQQTVRD
LESKDEVPGSRLHLGSARRAAGSDADHLREQQRELEAMRQRLLSAARLLTSFTSQAVDRT
VNDWTSSNEKAVMSLLHTLEELKSDLSRPTSSQKKMAAELQFQFVDVLLKDNVSLTKALS
TVTQEKLELSRAVSKLEKLLKHHLQKGCSPSRSERSAWKPDETAPQSSLRRPDPGRLPPA
ASEEAHTSNVKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVF
PSKAERKITSRPFTRFRTAVRVVIAILRLRFLVKKWQEVDRKGALAQGKAPRPGPRARQP
QSPPRTRESPPTRDVPSGHTRDPARGRRLAAAASPHSGGRATPSPNSRLERSLTASQDPE
HSLTEYIHHLEVIQQRLGGVLPDSTSKKSCHPMIKQ
NT seq 10011 nt   +upstreamnt  +downstreamnt
atggaagttgagcaagagcagcggcgcagaaaggtggaggccgggaggacgaagcttgct
cacttccgacagagaaaaacaaaaggtgacagttcgcattcggagaaaaagacggcgaag
aggaagggctcggctgtcgatgcgtctgtccaggaggagagtccggtaaccaaggaggac
agcgcactctgtggaggaggggacatttgcaaaagcacatcatgtgacgacacccctgat
ggggcaggaggggcctttgcagctcagccggaggactgtgatggagagaagagagaggac
ttggaacagctgcagcagaagcaagtcaatgaccatcctccagagcagtgtgggatgttc
acagtcagtgaccacccaccagaacagcatgggatgttcacagtcggtgaccacccacca
gaacagcgtgggatgttcacagtcagtgaccacccaccagaacagcatgggatgttcaca
gtcagtgaccacccaccagaacagcgtgggatgttcacaatcagtgaccaccaaccggaa
cagcgtgggatgttcacagtcagtgaccacacaccagaacagcgtgggatcttcacaatc
agtgaccacccagcagaacagcgtgggatgttcacaaaggagtgtgaacaagaatgtgaa
cttgccattactgacctggagagcggccgtgaagatgaggctggcctgcatcagagtcag
gccgtgcatggccttgagctggaggcgctgcgcctgagtctgagcaacatgcacacggcg
cagctggagctgacacaggccaacctccagaaggagaaggagacggcattgacggagctg
cgggagatgctcaacagccggcgtgcccaggagctggccctgctacagagcaggcagcag
cacgagctggagctcctcagggagcagcacgcacgggagaaggaggaggtggtgctcagg
tgtggacaggaagcagctgagctgaaggagaagttacaatcagaaatggagaaaaacgcc
cagatagtaaagaccctgaaggaagattgggaatctgaaaaagatttatgtttagaaaat
ctacgcaaagaactgtctgcaaagcatcaatcagaaatggaggatttacaaaaccagttt
cagaaagaattggcagaacagagagctgagttggagaagatttttcaagacaaaaaccag
gctgaacgggcccttaggaacctggagagtcatcatcaagcagccattgagaagttacgt
gaagacctgcagtccgagcacggccggtgtttagaagacttggagttcaagttcaaagag
agcgagaaagaaaaacagctggagttagagaatcttcaagcatcatatgaagacctgaag
gcacaatcacaagaagagatcaggcgcttgtggtcccagcttgattctgccaggaccagt
agacaggaattgagtgagctacatgagcaactcctggcgcgcacctctcgtgtggaagat
ttagaacagctgaagcagcgagaaaaaacccagcatgagtccgaactggagcaactgagg
atttattttgaaaagaagttaagggatgctgagaaaacttaccaagaagacctaaccctg
ttacagcagaggctgcagggggcgagggaagatgctcttctggactctgtggaagttggg
ttgtcctgtgtgggtttagaagagaaacctgagaaaggaagaaaagatcacgttgatgaa
ctcgagcctgagcgacataaggagagcctgccacgcttccaggcggagttagaagaaagc
cacaggcaccagctggaagcgctggagtctcccctctgcatccagcacgaggggcatgtc
tcagacagatgctgcgtagagacttcagcattgggacacgagtggcgtctggaaccctct
gaagggcacagccaagagcttccctgggtgcatctccagggtgtgcaggacggggacttg
gaggccgacacagagcgggcagccagagtcttgggtctggaaactgagcacaaggtgcaa
ctttcgcttcttcagactgagctcaaagaagaaattgaactcctaaaaatagaaaataga
aatttgtatgggaagttgcagcatgaaactcgtctgaaggacgatttggagaaggtaaaa
cacaatctaattgaagaccaccagaaggaactaaataatgctaagcaaaagactgagctg
atgaaacaggaattccaaagaaaagaaacggactggaaagttatgaaggaggagctacag
cgggaagctgaggagaagttaacattgatgctacttgaactgagagaaaaggctgaatcc
gagaaacagaccatcataaacaagtttgagcttcgagaagctgaaatgaggcagcttcag
gaccaacaggcagcccagatcctggatctggagaggtccttgacggagcagcagggccgc
ctgcagcagctggaacaggacctcacttcagacgacgccctgcattgcagccagtgtggg
cgggagccgcccacagcccaggacggggagcttgctgcgctccacgtgaaggaagactgc
gccctgcagctgatgctggcccggagcaggtttttagaggaacgtaaagagatcaccgag
aaattcagtgcggaacaagatgccttcctgcaggaggcccaggagcagcatgcccgtgag
ctgcagctcctccaggagagacaccagcagcagctcctgtcagtgacggcggagctcgag
gccagacaccaggccgcgttgggcgagctgacagcctccttagagagcaagcagggggct
ctgctggctgcacgtgtggccgaactgcagacaaaacacgctgccgacctcggcgctctg
gagaccagacatctgtccagccttgattctttggaatcctgttacctctctgaatttcag
accatccgtgaggagcacaggcaggccctagagctcttacgagcagactttgaggaacaa
ctgtggaaaaaggactctcttcaccaaacgattttgactcaagagttggagaaactgaag
cggaaacacgaaggggagctacagtctgtgcgggaccacctgcgaaccgaagtgagcaca
gagctcgccggaaccgtggctcacgagctgcagggagtgcaccagggtgaatttggaagt
gaaaagaaaactgctttgcatgaaaaagaggagacacttcggcttcagagtgcacaggca
cagccttttcaccaagaggagaaagagtctttgtctctgcagcttcaaaagaagaatcac
caagtccagcagctgaaagaccaggttttatccttaagtcacgagatagaagagtgccgc
tccgagttggaggtgctgcagcagaggcgggagcgggagaaccgggaaggcgcaaacctc
ctctccatgctcaaggccgacgtcaacctgtcccacagcgaaagaggggccctccaggac
gccctgcgcaggctgctgggtttgtttggagagacgctgagggcagccgtcaccctgagg
agccggatcggggagcgcgtggggctctgcctggatgacgcgggcgcaggcctggccctg
tcgacagctccggcgctggaggagacatggtctgatgtggccctcccggagttggacaga
actttgtctgaatgtgcagagatgtcttccgtggctgaaattagcagccacatgcgtgaa
agctttctcatgagcccagaaagtgtgcgggagtgtgagcagcccatccggagggtcttc
cagagcctcagcctggccgtggacggcctcatggagatggccctggactccagcaggcag
ctggaagaagcacgccaaattcattctcgttttgaaaaagaatttagttttaagaatgag
gagacagcacaggttgtcaggaagcaccaggagctgctggagtgtttgaaggaggagagc
gcagcaaaggcagagctggcgctggagctgcacaagactcagggtacccttgagggattc
aaggtggagacagcagatctgaaggaggtgctggccgggaaggaggattccgagcaccgt
ctggtgctggagctggagagcctgagacggcagctgcagcaggcggcccaggagcaggcg
gcgctgagggaggagtgcacccgtctgtggagtcggggggaggccacagccacggacgcc
gaggccagagaagctgctctccggaaggaagtggaggatctgaccaaagaacagtcggag
accaggaagcaggctgagaaggaccgctcagccctgctctcccagatgaagattttggag
tctgagttagaagaacagctgtctcagcatcgcgggtgtgccaagcaggcggaggccgtc
actgccctggaacagcaggtggcatctctggacaagcatttgcgcaaccagcggcaattc
atggatgagcaggcagccgagcgggagcacgagcgcgaggagttccagcaggagattcag
aggctggaggggcagctccgccaggcggccaagccgcagccctggggccctcgcgacagc
cagcaggcgccgctggatggagaggttgagttgttacaacaaaagttgagagaaaagttg
gatgaatttaatgaattggctatacagaaagagtcggcagatagacaagtgttaatgcag
gaagaagaaattaaacgtctggaggagatgaacatcaacatcaggaaaaaagtggcccag
ctccaggaagaagtggaaaaacagaaaaacatcgtgaaagggctggaacaggataaagag
gtgttaaagaaacagcagatgagtagcttgcttctggcgtccacgttgcagtctacacta
gatgcaggcagatgtcccgagcctccttcgggcagccctcctgagggtccagaaatacag
ttagaggtgacacagagagcactcctgcggcgcgagagcgaggttttggacttaaaagaa
cagctagaaaagatgaaaggtgacttagaaagtaaaaatgaagaaatactacatctgaac
ttaaaattggacatgcagaacagccagactgctgtcagcctcagagaacttgaggaagag
aacacgagcttgaaggtcatatataccagaagttctgagattgaagagctgaaagccact
attgaaaatctgcaagagaatcagaaacgattacaaaaggagaaagcagaggaaattgaa
caactccatgaagtcattgagaagctgcagcacgagctgtccctcatggggcctgtggtg
cacgaagtcagcgacagtcaggctggcagtctgcagagcgagctgctctgctcccaggcc
gggggccctcgtgggcaggccctacagggcgagctcgaggctgcgctggaagccaaggag
gccctgagccggctgctggctgaccaggagcgcaggcacagccaggccctggaggccctg
cagcagcgcctccagggcgcagaggaggctgcggagctacagctggctgagctggagcgc
aatgtagccctcagggaggctgaggtcgaagacatggcctcccggatccaggagttcgaa
gcggccctgaaagcaaaggaagcgacgattgccgagagaaatttagaaatcgacgctctg
aaccagcggaaggcggcccactctgccgagctggaggccgtcctgttggccttggcccgc
atccgccgcgccctggagcagcagcccctggcagccggggcggcgcctcccgagctgcag
tggctccgagcgcagtgtgcccgcctcagccgccagctgcaggtgctgcaccagcggttc
ctgaggtgccaggtggagctggacaggcggcaggcccgcagagccacagctcacacacgg
gtgcccggggcccacccacagcctcgcatggatggtggcgccaaggcccaggtcaccggc
gacgtggaggcctcccatgatgctgctttggagccggttgtccctgacccacagggtgat
ctgcagcctgtcctggtgacgttgaaggatgcacctctctgcaagcaagaaggcgtgatg
tcagtgctcaccgtctgccagaggcagctgcagtcggagctgctcttggtgaaaaatgaa
atgcgcctgagtctggaggacggcggcaagggtaaagaaaaagtactggaagattgtcag
ctgccgaaggtcgatctcgtagctcaggtgaaacagcttcaggaaaaactgaaccgtttg
ctgtattccatgaccttccagaatgtggatgctgccgacaccaaatctctgtggcccatg
gcctcagcacacctgttggagagcagctggagtgatgattcctgtgacggagaagagcct
gacatatcaccccacatagacacatgtgatgccaatacagccacggggggtgtaactgat
gttatcaaaaatcaggccatagacgcgtgtgatgccaatacaaccccagggggtgtaact
gatgttatcaaaaattgggattccttgataccagatgaaatgccagattctcccattcaa
gaaaaatcagaatgtcaggacatgtctctttcttcaccgaccagcgtacttggtggctcc
cgccaccagagccacactgcagaggctgggccccggaagagcccggtcgggatgctggac
ctgtcttcctggagctcccctgaggtcctcaggaaggactggaccctggagccctggccc
agcctccccgtgacaccccactcaggagccctgagcctgtgcagtgccgacacatccctg
ggggacagggcggacacctcgctgccacagacccaggggccggggctgctttgttcccca
ggcgtgtctgcagcagcgctggcactgcagtgggccgagtctccgccggctgacgaccac
catgtgcagaggacggctgtggagaaagatgtcgaagattttatcacaacatcctttgat
tctcaagaaacattaagttcacctcctcctggattagaaggaaaagctgatagaagtgag
aaaagtgacggctcgggttttggagcaagactgagcccggggtcaggaggccctgaggct
caaactgctggtcctgtgacccctgcttccatctctggaaggtttcagccgctgccggaa
gccatgaaggagaaggaagtgcgtccgaagcacgtgaaggctttactgcagatggtgcgt
gacgagagccaccagatcctggcgctgtcagaaggccttgcacccccaagcggcgagcca
cacccaccccggaaggaagacgagatacaggacatctcgctccatgggggaaagacgcag
gaagtgcccaccgcgtgccccgattggagaggggaccttctgcaggttgtgcaagaggcc
tttgaaaaagagcaggagatgcagggggttgagctgcagccccgactcagtggctcagat
ctggggggtcacagctccctgctcgaaaggctggagaagatcatccgtgagcagggagac
ctgcaggaaaagtccctggagcatcttcgcttgccggaccggagcagcctgctgtccgag
atccaggcgctgcgtgcccagctgcgcatgacgcacctgcagaaccaggagaagctgcag
cacttgcgcacggcgctgacaagcgcagaggcgcgcgggagccagcaggagcaccagctg
cgcaggcaggttgaactgctggcttataaagtagagcaggagaagtgcattgctggtgac
ttgcagaagacgctgagtgaagagcaagagaaggcaaacagcgtgcagaagctcctggcg
gcggagcagactgtagtgcgagatttgaagtccgacctctgtgagagcaggcagaagagc
gaacagctgtcccggtccctctgcgaggtgcagcaggaggtcctccagctgagatccatg
ctgagcagtaaggagaacgagctgaaggccgcgcttcaggagctggagagtgagcagggg
aaggggcgtgccctgcagagccagctggaggaggagcagctgcggcacctgcagagggag
agccagagtgccaaggccctggaggagctgcgggcgtctttggagacacagcgtgctcag
agcagtcgactctgcgtggcactgaaacacgagcagacggccaaggacaacctgcagaag
gagctgcgtatcgagcactcacgctgcgaggccttgctggctcaggagcggagccagctc
tctgagctccagaaggaccttgcggctgagaagagccgcaccctggagctgtcagaggcc
ttgcggcacgagcggctcctgaccgagcagctgagccagaggacacaggaggcttgcgtg
caccaggacacacaggcccatcacgctctgctgcagaagctgaaggaggagaagtcccgg
gtggtggacttgcaagcgatgcttgaaaaggtgcagcagcaagccctgcattctcagcag
cagcttgaggctgaggctcagaagcactgtgaggcgctcaggagagagaaggaggtaagt
gccacactgaagtcgacggtggaagccctgcacacccaaaaacgagagctgagatgctct
ctggagagagagagggagaaaccagcgtggttgcaggcagaattagagcagtcacaccca
cggttgaaagagcaagaaggacgcaaggctgcgaggaggagcgcggaggccaggcagagc
ccagcggctgcggagcagtggaggaagtggcagagagacaaggagaagctgcgagaatta
gaactgcagcgtcagcgtgacttgcataagatcaagcagcttcagcagacagtgagagac
ctggagtcgaaggacgaggtgcctggcagccgcctccacctaggttctgcccgcagggct
gccggctcggatgcggaccacctccgggaacagcagcgagagctggaggcgatgaggcag
cggctgctctctgccgcccggcttctcaccagcttcaccagccaggccgtggacaggaca
gttaatgattggacgtcatccaatgagaaagcagtgatgtctttactgcacacgttggag
gagctgaagtctgacttgagcaggcccacctcctcccagaaaaaaatggcagcagagctg
cagttccagtttgtggacgtcctgctgaaagacaatgtttccctcacaaaagcgctcagc
acggtgacccaggagaagctggagctgagcagagccgtgtctaagcttgagaagttgctg
aagcaccatctgcagaagggctgcagcccaagcaggtcggaaaggtctgcttggaagcca
gacgaaacggctccacagagttccctgaggcgcccagaccccggccggcttccaccagct
gccagcgaggaagcacacaccagcaatgtcaagatggaaaaattgtacctgcattacttg
agagcagagagctttagaaaagctctgatttatcaaaagaagtatcttttgctgttgatt
ggtggattccaggattctgaacaagaaacactctccatgattgcccatttgggggtattt
ccttccaaagcagaacggaaaatcacatctcgtcctttcaccaggttccgcacggccgtc
agggtggtcattgcaatattaagattacgttttttggttaagaaatggcaagaagtagat
cggaaaggagctctggcacaaggcaaagcccctcgcccagggccccgagcacgacagccg
cagtctccacccagaaccagagagtcccccccaacccgggatgtaccctctggccacacc
agggaccctgccagaggccgcagactggcagcagcagcctccccacacagtgggggaaga
gccactccatccccaaattcaagattagaaagatccctgactgcttctcaagatccagaa
cattccttgacagagtatattcaccatttagaagtgatccagcaaagattgggaggggta
ctaccagattctacttcaaagaaatcctgccacccgatgattaaacagtga

DBGET integrated database retrieval system