KEGG   Homo sapiens (human): 51161
Entry
51161             CDS       T01001                                 
Symbol
C3orf18, G20
Name
(RefSeq) chromosome 3 open reading frame 18
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CEP19 DUF6479
Other DBs
NCBI-GeneID: 51161
NCBI-ProteinID: NP_001165211
HGNC: 24837
Ensembl: ENSG00000088543
Pharos: Q9UK00(Tdark)
UniProt: Q9UK00
Position
3:complement(50558025..50574700)
AA seq 162 aa
MNSRTASARGWFSSRPPTSESDLEPATDGPASETTTLSPEATTFNDTRIPDAAGGTAGVG
TMLLSFGIITVIGLAVALVLYIRKKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRD
AASVQAATSVQAMQGKTTLPSQGPLQRPSRLVFTDVANAIHA
NT seq 489 nt   +upstreamnt  +downstreamnt
atgaactccaggaccgcatctgctaggggctggttcagcagccgcccacccacctctgag
tctgacctggaacctgccacagatgggccagcctccgagaccactaccctcagcccagag
gccaccacctttaatgacaccagaatccctgatgcagctggtggcacggccggcgtgggt
accatgcttctgtcctttgggatcatcacggtgataggcctggctgtggccttggttttg
tacatcaggaagaagaagaggctggagaagctacgccaccagctcatgcccatgtacaac
ttcgaccccacggaggaacaagatgagttggagcaggagctgctggagcatgggcgggac
gccgcctctgtacaggctgctacttctgtgcaggccatgcagggcaagactactctgccc
tcccagggcccactgcagagacccagccggctggtgtttaccgatgtggccaatgccatc
catgcgtga

DBGET integrated database retrieval system