KEGG   Homo sapiens (human): 51171
Entry
51171             CDS       T01001                                 

Gene name
HSD17B14, DHRS10, SDR47C1, retSDR3
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 14
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD Polysacc_synt_2 Sacchrp_dh_NADP 3HCDH_N NAD_binding_7 TrkA_N
Other DBs
NCBI-GeneID: 51171
NCBI-ProteinID: NP_057330
OMIM: 612832
HGNC: 23238
Ensembl: ENSG00000087076
Vega: OTTHUMG00000183328
Pharos: Q9BPX1(Tbio)
UniProt: Q9BPX1 A0A140VJH8
Structure
PDB: 

Position
19q13.33
AA seq 270 aa
MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFIL
CDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYT
LTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVN
CISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTG
IELLVTGGAELGYGCKASRSTPVDAPDIPS
NT seq 813 nt   +upstreamnt  +downstreamnt
atggctacgggaacgcgctatgccgggaaggtggtggtcgtgaccgggggcgggcgcggc
atcggagctgggatcgtgcgcgccttcgtgaacagcggggcccgagtggttatctgcgac
aaggatgagtctgggggccgggccctggagcaggagctccctggagctgtctttatcctc
tgtgatgtgactcaggaagatgatgtgaagaccctggtttctgagaccatccgccgattt
ggccgcctggattgtgttgtcaacaacgctggccaccacccacccccacagaggcctgag
gagacctctgcccagggattccgccagctgctggagctgaacctactggggacgtacacc
ttgaccaagctcgccctcccctacctgcggaagagtcaagggaatgtcatcaacatctcc
agcctggtgggggcaatcggccaggcccaggcagttccctatgtggccaccaagggggca
gtaacagccatgaccaaagctttggccctggatgaaagtccatatggtgtccgagtcaac
tgtatctccccaggaaacatctggaccccgctgtgggaggagctggcagccttaatgcca
gaccctagggccacaatccgagagggcatgctggcccagccactgggccgcatgggccag
cccgctgaggtcggggctgcggcagtgttcctggcctccgaagccaacttctgcacgggc
attgaactgctcgtgacggggggtgcagagctggggtacgggtgcaaggccagtcggagc
acccccgtggacgcccccgatatcccttcctga

DBGET integrated database retrieval system