KEGG   Homo sapiens (human): 51175Help
Entry
51175             CDS       T01001                                 

Gene name
TUBE1, TUBE, dJ142L7.2
Definition
(RefSeq) tubulin epsilon 1
  KO
K10391  tubulin epsilon
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    51175 (TUBE1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    51175 (TUBE1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     51175 (TUBE1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    51175 (TUBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_2 Tubulin_3
Motif
Other DBs
NCBI-GeneID: 51175
NCBI-ProteinID: NP_057346
OMIM: 607345
HGNC: 20775
Ensembl: ENSG00000074935
Vega: OTTHUMG00000015382
Pharos: Q9UJT0(Tdark)
UniProt: Q9UJT0
Position
6q21
AA seq 475 aa AA seqDB search
MTQSVVVQVGQCGNQIGCCFWDLALREHAAVNQKGIYDEAISSFFRNVDTRVVGDGGSIS
KGKICSLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLY
QDQILEKFRKSAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPEVYRFVTSIYPS
GEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLV
TSSSGALKKQHKKPFDAMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLV
SSLTPLYTLTDVNIPPRRLDQMFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLR
RNIERLKPSLQFVSWNQEGWKTSLCSVPPVGHSHSLLALANNTCVKPTFMELKERFMRLY
KKKAHLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIAM
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcggtggtcgtacaggtcggccagtgcggaaaccagatcggctgctgcttc
tgggacctggcactaagggagcacgccgcggtcaaccagaaaggaatttatgatgaggca
ataagcagcttctttagaaatgtggacaccagagtggttggtgatggtggaagtatttcc
aagggaaaaatatgttctttaaaagcacgagcagtcttgattgatatggaagaaggggta
gtgaatgaaattctgcagggaccactgagagatgtatttgatacgaaacagctcatcact
gatatttctggctcaggaaataattgggccgtgggtcacaaagttttcggcagtctttac
caagaccagattttagagaaattcagaaagtcggcagagcactgtgattgcttgcagtgt
ttctttataatacattccatgggaggaggaacaggatctggacttggcacatttctttta
aaggtgcttgaagacgaattcccagaagtatacagatttgtgacttccatttatccttct
ggtgaggatgatgtcataacctcaccttataatagcatcttggcaatgaaggaacttaat
gagcatgcagactgtgtattgcccattgacaatcaatctttatttgacatcattagcaaa
atcgacctcatggtgaattctggaaagttgggtacaactgtgaagccaaagagtctggtt
acttcaagttctggggctttaaaaaagcagcataagaagccctttgatgcaatgaataac
attgtggcaaatttgctcctcaacctaacgagctctgcaagatttgaagggtcccttaat
atggaccttaatgaaatcagcatgaatttagttccttttcctcaacttcattatctcgtg
tcaagcctaacacctctgtatacactgacagatgttaacattcctcctagaagattggat
cagatgttttcagatgcctttagtaaagatcaccagctgcttcgggcagaccccaaacac
agtctttacctcgcctgtgcactcatggttagaggaaatgtacaaatttcagatcttcgt
agaaatattgaaagattaaaaccatctctacaatttgtctcctggaatcaagaaggctgg
aagaccagcctgtgttccgtacctcctgtgggccattctcattcgttattagctttagca
aataacacatgtgtgaagcccaccttcatggaactgaaagagagattcatgaggctctac
aagaaaaaggctcaccttcatcactatctacaagttgaagggatggaagaaagctgtttc
acagaagctgtgtcatctttatcagcactcatacaggaatatgaccaactggacgccaca
aaaaacatgcctgtgcaggatttacccagactaagcatagctatgtga

DBGET integrated database retrieval system