KEGG   Homo sapiens (human): 51181
Entry
51181             CDS       T01001                                 

Gene name
DCXR, DCR, HCR2, HCRII, KIDCR, P34H, PNTSU, SDR20C1, XR
Definition
(RefSeq) dicarbonyl and L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa01100  Metabolic pathways
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Disease
H01065  Pentosuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    51181 (DCXR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     51181 (DCXR)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Shikimate_DH ADH_zinc_N DUF3742 NAD_binding_10 RmlD_sub_bind AdoHcyase_NAD DUF1776 NAD_binding_7 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 51181
NCBI-ProteinID: NP_057370
OMIM: 608347
HGNC: 18985
Ensembl: ENSG00000169738
Vega: OTTHUMG00000178483
Pharos: Q7Z4W1(Tbio)
UniProt: Q7Z4W1 A0A384NY14
Structure
PDB: 
3D3W 1PR9 1WNT

Position
17q25.3
AA seq 244 aa
MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVD
LGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVAR
GLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPT
VVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG
FWAC
NT seq 735 nt   +upstreamnt  +downstreamnt
atggagctgttcctcgcgggccgccgggtgctggtcaccggggcaggcaaaggtataggg
cgcggcacggtccaggcgctgcacgcgacgggcgcgcgggtggtggctgtgagccggact
caggcggatcttgacagccttgtccgcgagtgcccggggatagaacccgtgtgcgtggac
ctgggtgactgggaggccaccgagcgggcgctgggcagcgtgggccccgtggacctgctg
gtgaacaacgccgctgtcgccctgctgcagcccttcctggaggtcaccaaggaggccttt
gacagatcctttgaggtgaacctgcgtgcggtcatccaggtgtcgcagattgtggccagg
ggcttaatagcccggggagtcccaggggccatcgtgaatgtctccagccagtgctcccag
cgggcagtaactaaccatagcgtctactgctccaccaagggtgccctggacatgctgacc
aaggtgatggccctagagctcgggccccacaagatccgagtgaatgcagtaaaccccaca
gtggtgatgacgtccatgggccaggccacctggagtgacccccacaaggccaagactatg
ctgaaccgaatcccacttggcaagtttgctgaggtagagcacgtggtgaacgccatcctc
tttctgctgagtgaccgaagtggcatgaccacgggttccactttgccggtggaagggggc
ttctgggcctgctga

DBGET integrated database retrieval system