KEGG   Homo sapiens (human): 51182
Entry
51182             CDS       T01001                                 

Gene name
HSPA14, HSP70-4, HSP70L1
Definition
(RefSeq) heat shock protein family A (Hsp70) member 14
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: HSP70 MreB_Mbl Actin FtsA A_amylase_inhib
Other DBs
NCBI-GeneID: 51182
NCBI-ProteinID: NP_057383
OMIM: 610369
HGNC: 29526
Ensembl: ENSG00000187522
Vega: OTTHUMG00000191882
Pharos: Q0VDF9(Tbio)
UniProt: Q0VDF9
Position
10p13
AA seq 509 aa
MAAIGVHLGCTSACVAVYKDGRAGVVANDAGDRVTPAVVAYSENEEIVGLAAKQSRIRNI
SNTVMKVKQILGRSSSDPQAQKYIAESKCLVIEKNGKLRYEIDTGEETKFVNPEDVARLI
FSKMKETAHSVLGSDANDVVITVPFDFGEKQKNALGEAARAAGFNVLRLIHEPSAALLAY
GIGQDSPTGKSNILVFKLGGTSLSLSVMEVNSGIYRVLSTNTDDNIGGAHFTETLAQYLA
SEFQRSFKHDVRGNARAMMKLTNSAEVAKHSLSTLGSANCFLDSLYEGQDFDCNVSRARF
ELLCSPLFNKCIEAIRGLLDQNGFTADDINKVVLCGGSSRIPKLQQLIKDLFPAVELLNS
IPPDEVIPIGAAIEAGILIGKENLLVEDSLMIECSARDILVKGVDESGASRFTVLFPSGT
PLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVL
TMKRDGSLHVTCTDQETGKCEAISIEIAS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggcggccatcggagttcacctgggctgcacctcagcctgtgtggccgtctataaggat
ggccgggctggtgtggttgcaaatgatgccggtgaccgagttactccagctgttgttgct
tactcagaaaatgaagagattgttggattggcagcaaaacaaagtagaataagaaatatt
tcaaatacagtaatgaaagtaaagcagatcctgggcagaagctccagtgatccacaagct
cagaaatacatcgcggaaagtaaatgtttagtcattgaaaaaaatgggaaattacgatat
gaaatagatactggagaagaaacaaaatttgttaacccagaagatgttgccagactgata
tttagtaaaatgaaagaaacggcacattctgtattgggctcagatgcaaatgatgtagtt
attactgtcccgtttgattttggagaaaagcaaaaaaatgctcttggagaagcagctaga
gctgctggatttaatgttttgcgattaattcacgaaccgtctgcagctcttcttgcttat
ggaattggacaagactcccctactggaaaaagcaatattttggtgtttaagcttggagga
acatccttatctctcagcgtcatggaagttaacagtggaatatatcgggttctttcaaca
aacactgatgataacatcggtggtgcacatttcacagaaaccttagcacagtatctagct
tctgagttccaaagatccttcaaacatgatgtgagaggaaatgcgcgagccatgatgaaa
ttaacgaacagtgctgaagtagcgaaacattctttgtcaaccttgggaagtgccaactgt
tttcttgactcattatatgaaggtcaagattttgattgcaatgtgtccagagcaagattt
gaacttctttgttctccactttttaataagtgtatagaagcaatcagaggactcttagat
caaaatggatttacagcagatgatatcaacaaggttgtcctttgtggagggtcttctcga
atcccaaagctacagcaactgattaaagatcttttcccagctgttgagcttctcaattct
atccctcctgatgaagtgatccctattggtgcagctatagaagcaggaattcttattggg
aaagaaaacctgttggtggaagactctcttatgatagagtgttcagccagagatatttta
gttaagggtgtggacgaatcaggagccagtagattcacagtgctgtttccatcagggact
cctttgccagctcgaagacaacacacattgcaagcccctggaagcatatcttcagtgtgc
cttgaactctatgagtctgatgggaagaactctgccaaagaggaaaccaagtttgcacag
gttgtactccaggatttagataaaaaagaaaatggattacgtgatatattagctgttctt
actatgaaaagggatggatctttacatgtgacatgcacagatcaagaaactggaaaatgt
gaagcaatctctattgagatagcatcttag

DBGET integrated database retrieval system