KEGG   Homo sapiens (human): 51185Help
Entry
51185             CDS       T01001                                 

Gene name
CRBN, MRT2, MRT2A
Definition
(RefSeq) cereblon
  KO
K11793  cereblon
Organism
hsa  Homo sapiens (human)
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51185 (CRBN)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     51185 (CRBN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LON_substr_bdg Yippee-Mis18 Baculo_ME53
Motif
Other DBs
NCBI-GeneID: 51185
NCBI-ProteinID: NP_057386
OMIM: 609262
HGNC: 30185
Ensembl: ENSG00000113851
Vega: OTTHUMG00000090261
Pharos: Q96SW2(Tclin)
UniProt: Q96SW2 A0A024R2H8
Structure
PDB: 

Position
3p26.2
AA seq 442 aa AA seqDB search
MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYL
GADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTF
AVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSW
PRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLK
IGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETL
TVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRS
ALLPTIPDTEDEISPDKVILCL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgaaggagatcagcaggacgctgcgcacaacatgggcaaccacctgccgctc
ctgcctgcagagagtgaggaagaagatgaaatggaagttgaagaccaggatagtaaagaa
gccaaaaaaccaaacatcataaattttgacaccagtctgccgacatcacatacataccta
ggtgctgatatggaagaatttcatggcaggactttgcacgatgacgacagctgtcaggtg
attccagttcttccacaagtgatgatgatcctgattcccggacagacattacctcttcag
ctttttcaccctcaagaagtcagtatggtgcggaatttaattcagaaagatagaaccttt
gctgttcttgcatacagcaatgtacaggaaagggaagcacagtttggaacaacagcagag
atatatgcctatcgagaagaacaggattttggaattgagatagtgaaagtgaaagcaatt
ggaagacaaaggttcaaagtccttgagctaagaacacagtcagatggaatccagcaagct
aaagtgcaaattcttcccgaatgtgtgttgccttcaaccatgtctgcagttcaattagaa
tccctcaataagtgccagatatttccttcaaaacctgtctcaagagaagaccaatgttca
tataaatggtggcagaaataccagaagagaaagtttcattgtgcaaatctaacttcatgg
cctcgctggctgtattccttatatgatgctgagaccttaatggacagaatcaagaaacag
ctacgtgaatgggatgaaaatctaaaagatgattctcttccttcaaatccaatagatttt
tcttacagagtagctgcttgtcttcctattgatgatgtattgagaattcagctccttaaa
attggcagtgctatccagcgacttcgctgtgaattagacattatgaataaatgtacttcc
ctttgctgtaaacaatgtcaagaaacagaaataacaaccaaaaatgaaatattcagttta
tccttatgtgggccgatggcagcttatgtgaatcctcatggatatgtgcatgagacactt
actgtgtataaggcttgcaacttgaatctgataggccggccttctacagaacacagctgg
tttcctgggtatgcctggactgttgcccagtgtaagatctgtgcaagccatattggatgg
aagtttacggccaccaaaaaagacatgtcacctcaaaaattttggggcttaacgcgatct
gctctgttgcccacgatcccagacactgaagatgaaataagtccagacaaagtaatactt
tgcttgtaa

DBGET integrated database retrieval system