KEGG   Homo sapiens (human): 51186
Entry
51186             CDS       T01001                                 

Gene name
TCEAL9, WBP5, WEX6
Definition
(RefSeq) transcription elongation factor A like 9
Organism
hsa  Homo sapiens (human)
Motif
Pfam: BEX FAM176
Other DBs
NCBI-GeneID: 51186
NCBI-ProteinID: NP_001006613
HGNC: 30084
Ensembl: ENSG00000185222
Vega: OTTHUMG00000022097
Pharos: Q9UHQ7(Tdark)
UniProt: Q9UHQ7
Position
Xq22.2
AA seq 104 aa
MKSCQKMEGKPENESEPKHEEEPKPEEKPEEEEKLEEEAKAKGTFRERLIQSLQEFKEDI
HNRHLSNEDMFREVDEIDEIRRVRNKLIVMRWKVNRNHPYPYLM
NT seq 315 nt   +upstreamnt  +downstreamnt
atgaaatcctgtcaaaaaatggaaggaaaaccagaaaatgagagtgaaccaaagcatgag
gaagagccaaagcctgaggaaaagccagaagaggaggagaagctagaggaggaggccaaa
gcaaaaggaacttttagagaaaggctgattcaatctctccaggagtttaaagaagatata
cacaacaggcatttaagcaatgaagatatgtttagagaagtggatgaaatagatgagata
aggagagtcagaaacaaacttatagtgatgcgttggaaggttaatcgaaaccatccttac
ccctatttaatgtag

DBGET integrated database retrieval system