KEGG   Homo sapiens (human): 51187
Entry
51187             CDS       T01001                                 

Gene name
RSL24D1, C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, TVAS3
Definition
(RefSeq) ribosomal L24 domain containing 1
  KO
K02896  large subunit ribosomal protein L24e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    51187 (RSL24D1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    51187 (RSL24D1)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    51187 (RSL24D1)
  Archaea
    51187 (RSL24D1)
SSDB
Motif
Pfam: Ribosomal_L24e DUF1091
Other DBs
NCBI-GeneID: 51187
NCBI-ProteinID: NP_057388
OMIM: 613262
HGNC: 18479
Ensembl: ENSG00000137876
Vega: OTTHUMG00000131957
Pharos: Q9UHA3(Tdark)
UniProt: Q9UHA3 A0A024R5U8
Position
15q21.3
AA seq 163 aa
MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG
KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK
VQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEDAP
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcgtatcgaaaagtgttatttctgttcggggcccatctatcctggacacggcatgatg
ttcgtccgcaacgattgcaaggtgttcagattttgcaaatctaaatgtcataaaaacttt
aaaaagaagcgcaatcctcgcaaagttaggtggaccaaagcattccggaaagcagctggt
aaagagcttacagtggataattcatttgaatttgaaaaacgtagaaatgaacctatcaaa
taccagcgagagctatggaataaaactattgatgcgatgaagagagttgaagaaatcaaa
cagaagcgccaagctaaatttataatgaacagattgaagaaaaataaagagctacagaaa
gttcaggatatcaaagaagtcaagcaaaacatccatcttatccgagcccctcttgcaggc
aaagggaaacagttggaagagaaaatggtacagcagttacaagaggatgtggacatggaa
gatgctccttaa

DBGET integrated database retrieval system