KEGG   Homo sapiens (human): 51196Help
Entry
51196             CDS       T01001                                 

Gene name
PLCE1, NPHS3, PLCE, PPLC
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04070  Phosphatidylinositol signaling system
hsa04919  Thyroid hormone signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05205  Proteoglycans in cancer
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H01657  Nephrotic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    51196 (PLCE1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    51196 (PLCE1)
   04015 Rap1 signaling pathway
    51196 (PLCE1)
   04020 Calcium signaling pathway
    51196 (PLCE1)
   04070 Phosphatidylinositol signaling system
    51196 (PLCE1)
   04024 cAMP signaling pathway
    51196 (PLCE1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    51196 (PLCE1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    51196 (PLCE1)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    51196 (PLCE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51196 (PLCE1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     51196 (PLCE1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    51196 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    51196 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y RasGEF RA C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 51196
NCBI-ProteinID: NP_057425
OMIM: 608414
HGNC: 17175
Ensembl: ENSG00000138193
Vega: OTTHUMG00000018789
Pharos: Q9P212(Tbio)
UniProt: Q9P212
Structure
PDB: 

Position
10q23.33
AA seq 2302 aa AA seqDB search
MTSEEMTASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGETSHTISQLNKL
KEEPSGSNLPKILSIAREKIVSDENSNEKCWEKIMPDSAKNLNINCNNILRNHQHGLPQR
QFYEMYNSVAEEDLCLETGIPSPLERKVFPGIQLELDRPSMGISPLGNQSVIIETGRAHP
DSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMEL
AKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKTFLSHF
EDFPDNCDDVEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLTA
WSYIDQKRNGPLLPCGRVMEPPSTVEIRQDGSQRLSEAQWYPIYNAVRREETENTVGSLL
HFLTKLPASETAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGAR
SGLLSTFGGSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILM
EQEQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMR
FNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMW
QFMDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGA
SGLMKLCPRYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRS
LETDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFD
HGTELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTAS
PASSKAKLGVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQN
KLGSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQ
QWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLG
ISTTKKKKKILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEVNAIANP
PNPLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGM
KGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTI
DENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLG
IFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENF
ASKNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDC
WDGDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEI
FKTVFGEKLVTKFLFETDFSDDPMLPSPDQLRKKVLLKNKKLKAHQTPVDILKQKAHQLA
SMQVQAYNGGNANPRPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYN
EEIPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGL
STLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLN
PTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLTQHTACQLLRTYPAATRIDSSNPN
PLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLE
RDLDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMW
NEQFLFHVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISS
LFINSRRMEENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQ
LLQQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEEIMQILSSWFPE
EGYMGRIVLKTQQENLEEKNIVQDDKEVILSSEEESFFVQVHDVSPEQPRTVIKAPRVST
AQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQECVFQ
AQSKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQLLTSES
IQTKEEKPVGGLSSSDTMDYRQ
NT seq 6909 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaatgacagcttctgttctcatacctgtgactcagagaaaagtggtt
tctgcccagtcggctgcagatgaaagtagtgaaaaggtctcagacatcaatatttcaaaa
gcacatactgtcagacgaagtggggagacttctcataccatctcacaactgaacaaactt
aaagaagaaccttctggaagcaacttgccaaagattctctcaatagcgagggagaaaata
gtgagtgatgagaacagtaatgaaaaatgttgggagaaaatcatgccagattctgcgaaa
aaccttaacattaactgcaacaacatattgagaaaccatcagcatggccttcctcagaga
caattttatgaaatgtacaactctgttgctgaggaagacttgtgtttagaaactggaatt
ccttctccactggaaagaaaggtgttccctggaattcaactggaactagacagaccttcc
atgggcattagtcctttaggaaatcagtcagtgatcatagagacaggcagagcacaccct
gacagcagaagggcagtatttcattttcattatgaagttgacagaagaatgtcagacact
ttctgtaccctatcagaaaacttaattttagacgattgtggaaattgtgtaccactacct
gggggtgaggagaagcaaaagaaaaactatgtggcatatacctgtaaactgatggaattg
gccaaaaattgtgataataagaatgagcagctgcagtgtgatcattgtgacaccttgaat
gataaatacttttgctttgaaggctcttgtgagaaggttgacatggtatattcaggtgat
agcttttgtaggaaagactttactgacagtcaagctgccaagacctttttgagccatttt
gaggacttccctgataattgtgatgatgtagaagaagacgcttttaaaagcaaaaaggag
cgatccactttgttagtcaggagattctgtaaaaatgacagagaagttaagaaatctgtg
tatactggaacaagagcaattgtgagaactctgccttctggccacattgggctgactgca
tggagttacatagatcagaagagaaatggtcccttactgccttgtgggagagtaatggaa
cccccgtcaacagtggagataaggcaagatgggagccaacgtctgtcagaagcccagtgg
tatcctatctacaatgcagtgagaagagaagaaacagaaaatacagttggatctctactc
catttcctcaccaagctcccagcctccgagacagcccatggaaggataagcgttggtcca
tgcttaaagcaatgtgtccgagacactgtatgtgagtatcgcgccaccctccaaaggact
tcaatatcgcagtacatcaccggttctctcctagaagcaaccacgtctttgggagcaaga
agtggccttctcagtacttttggaggatccactggacgaatgatgctgaaagaacgccag
ccaggcccctctgtggccaattccaatgccctcccttcaagttcagctgggatcagcaag
gagctgatcgatctgcagcctctcatccagttcccagaggaagtcgccagcatcctgatg
gagcaagagcagactatttaccgcagggtcttgccagtcgactacctttgcttcttaaca
cgggacttgggcactcctgaatgccagagctccttgccctgcctcaaagcatccatctca
gcgtcgattcttaccactcagaatggagagcacaatgcccttgaagatctggtgatgagg
tttaatgaggtgagctcctgggtgacatggctgatcctcacggcaggctccatggaggag
aagcgagaagtcttttcatatttggtgcatgtggccaaatgctgctggaacatgggcaac
tacaacgctgtcatggagttcttggctggcctcaggtcaagaaaagttttaaaaatgtgg
cagttcatggaccagtctgatattgagaccatgaggagcctgaaggatgctatggcccag
catgagtcctcttgtgagtacagaaaggtggtgacacgtgccctgcacatccctggctgt
aaggtggttccattctgtggggtgtttctgaaggagctctgtgaagtgcttgacggcgcc
tccggtctcatgaagctttgcccgcggtacaattcccaagaagaaactttagagtttgta
gcagattacagtggacaagataatttcttacaacgagtgggacaaaatggcttaaagaat
tcggagaaggagtccactgtcaacagcatctttcaggtcatccggagctgcaatcgaagt
ctggagacagacgaggaggacagccccagtgaaggaaacagctccaggaaaagctccttg
aaggataaaagccgatggcagtttataattggagatttgttggattcagacaatgacatc
tttgagcaatccaaagaatacgactctcatggttcagaggactcacagaaggccttcgac
catgggacggagctcatcccttggtacgtgctgtccatccaagccgatgtgcaccagttc
ctgctgcagggggccacggtcatccactacgaccaggacacacacctctctgcccgctgc
ttcctccagcttcagcccgacaatagcaccttgacctgggtaaagcccacaactgcctcc
ccagccagcagtaaagcaaaacttggtgtacttaataacacagctgagcctggaaaattc
ccactactgggtaatgctggattaagtagcctgacggaaggggtcttggatctttttgca
gtgaaggctgtatacatgggccaccctggcattgatatacacactgtgtgtgttcagaac
aaactgggtagcatgttcctgtcagagactggtgtgacattgctctatgggcttcagacc
acagacaacagattattgcacttcgtggcaccaaagcacacagctaaaatgctcttcagc
ggattattggaactcactagagctgtgagaaagatgaggaaattccctgaccaaagacag
cagtggctgcggaaacagtacgtcagcctttatcaggaggatggacggtatgaaggccca
actttggctcacgctgtggagttgtttggtggcagacggtggagtgctcgaaaccccagc
cccggaacatcagcaaagaatgctgagaagcccaatatgcagagaaacaataccctgggc
ataagcactaccaagaaaaagaagaaaatcctcatgaggggtgagagtggagaggtaact
gacgatgagatggcaacccgaaaggccaagatgcacaaagagtgtcgaagccggagtggt
tctgatcctcaagacattaatgaacaagaagaatcagaggtgaatgccatcgctaaccct
ccaaaccccctcccttccagaagagcccactctttgaccacagctgggtcccccaacttg
gctgccgggacgtcatctcccatcaggccagtgtcctcccctgtgctgtcttcttcaaac
aagagcccatccagtgcttggagcagtagtagctggcacgggcggatcaaaggcggcatg
aagggatttcagagcttcatggtttcagatagcaacatgagttttgttgaatttgttgag
ctgttcaaatcattcagtgtcaggagccgcaaggacctgaaggatctgtttgatgtctat
gcagtgccctgcaaccgatctggctccgagtcagccccactctacaccaacctgacaatt
gatgaaaacaccagcgatcttcagcctgacctagatctgttgaccagaaatgtctcggat
ttggggttgttcattaagagtaaacagcagctatcggacaaccagaggcagatatctgat
gccattgctgctgcaagcattgtgacaaatggcactgggattgagagcacatctctgggc
atttttggggtgggcatacttcagctcaacgatttcctcgtgaattgccaaggagaacac
tgcacttatgatgaaatcctcagcatcatccagaagttcgagcctagcatcagtatgtgt
catcagggactaatgtcatttgaagggtttgccaggtttctgatggataaagaaaatttt
gcctcaaaaaatgatgagtcacaggagaacattaaagaactgcagctacccctctcatac
tattacatcgaatcttcgcacaatacctacctcacgggccatcagctcaaaggagaatcc
tcggtagaactctacagccaggtccttttgcaaggctgtcgaagtgtagaattggactgc
tgggacggagacgatgggatgcccatcatttatcatggacatacgctgacaaccaagatc
cccttcaaggaagtggttgaagccattgatcgcagtgccttcatcaactctgacctgcca
atcatcatatcgattgagaaccactgttcattgcctcagcaacgaaaaatggcagaaatt
ttcaagactgtgtttggagaaaagctggtgactaaattcttatttgagactgatttctca
gatgatccaatgcttccttcacctgaccaactcagaaagaaagttcttcttaaaaacaag
aagctaaaagcccatcagacgccagtggatatcttaaagcaaaaggctcatcagttagca
tctatgcaagtgcaggcttataatggtgggaatgccaacccccgacctgccaataatgag
gaagaggaagatgaggaggacgaatatgattatgactatgaatccctttctgatgacaac
attctggaagacagacctgaaaataaatcatgtaatgacaagcttcagtttgaatataat
gaagaaatcccaaagaggataaagaaagcagataactctgcttgcaacaaaggaaaggtt
tatgatatggaactgggagaagaattttatcttgatcagaataaaaaggaaagcagacag
attgcaccagagctttctgaccttgtaatctattgtcaagcagtaaaatttccaggactg
tcaactctaaatgcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatt
tttggcaacaatccgggcagaatgagcccaggggagacagcatcatttaacaaaacatct
ggaaaaagttcctgtgaaggcattcgacagacctgggaggaatcttcttcccctctcaac
ccaaccacgtccctcagtgctatcattagaactcccaaatgttatcatatctcgtcgctg
aatgaaaatgccgccaaacgtctgtgtcgcaggtattctcagaaactgacccagcacacc
gcctgtcagctgctgagaacttaccctgctgccacccgcatcgactcttccaacccgaac
cccctcatgttctggctccatgggatacagcttgtggcactcaactaccagactgatgat
ctccctttacatttaaatgctgcaatgtttgaggcaaatggtggttgtggttatgtattg
aaacctccagttctgtgggacaagaactgccccatgtatcagaagttttctccactagaa
agagatctggacagcatggatcctgcagtctattctttaactattgtctctggtcagaat
gtgtgccccagtaatagcatgggaagcccgtgcattgaagtcgacgtcctgggcatgcct
ctggacagctgccatttccgcacaaagcccatccatcgaaacaccctgaaccccatgtgg
aacgagcagtttctgttccacgttcacttcgaagatcttgtatttcttcgttttgcagtt
gtggaaaacaatagttcagcggtaactgctcagagaatcattccactgaaagctttaaaa
cgaggatatcgacatcttcagctgcgaaaccttcacaatgaagtcttggagatttctagt
ttattcattaacagcagaaggatggaagaaaattcctctggcaataccatgtcagcctct
tcgatgtttaatacagaagaaagaaaatgtttgcagactcacagagtcacggtgcatggg
gtcccagggccagagccctttaccgttttcactattaatggaggcaccaaggcaaagcag
cttctgcagcaaattctgacaaatgaacaagacatcaaacctgttaccacagactatttt
ttgatggaagaaaaatattttatatctaaagaaaagaatgaatgtaggaaacaaccattc
cagagagccattggtccagaagaggagatcatgcaaattttaagcagctggtttccagaa
gagggatacatgggcaggattgtcttaaaaacccagcaggaaaacctagaagagaaaaac
attgttcaagatgacaaagaggtgatcttgagctcagaggaggagagtttctttgtccaa
gtgcatgatgtttctccagagcaacctcgaacagtcatcaaagcaccccgcgtcagcact
gcacaggatgtcattcagcagaccttatgcaaagccaaatattcctacagcatcctgagc
aaccccaatccaagcgactatgtgcttttggaagaggtggtgaaagacactaccaacaag
aagactaccacaccaaagtcctctcagcgggtccttctggatcaggagtgtgtgtttcaa
gcccaaagcaagtggaaaggtgcaggaaaattcatccttaagctaaaggagcaggtgcag
gcatctcgagaagataaaaagaaaggcatttctttcgcaagtgaactcaagaagctcacc
aagtcaactaaacagccccgaggacttacatcaccttctcagctcttgacctcagaaagt
atccaaaccaaggaggagaaacctgtgggtggcttgtcctccagtgacacaatggattac
cgacagtga

DBGET integrated database retrieval system