KEGG   Homo sapiens (human): 51206Help
Entry
51206             CDS       T01001                                 

Gene name
GP6, BDPLT11, GPIV, GPVI
Definition
(RefSeq) glycoprotein VI platelet
  KO
K06264  platelet glycoprotein VI
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
Disease
H01235  Bleeding disorder platelet-type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    51206 (GP6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    51206 (GP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig
Motif
Other DBs
NCBI-GeneID: 51206
NCBI-ProteinID: NP_057447
OMIM: 605546
HGNC: 14388
Ensembl: ENSG00000088053
Vega: OTTHUMG00000159709
Pharos: Q9HCN6(Tbio)
UniProt: Q9HCN6
Structure
PDB: 

Position
19q13.42
AA seq 339 aa AA seqDB search
MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLE
KLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQP
GPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRC
YSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFT
TETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRH
RGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgtctccatccccgaccgccctcttctgtcttgggctgtgtctggggcgtgtgccagcg
cagagtggaccgctccccaagccctccctccaggctctgcccagctccctggtgcccctg
gagaagccagtgaccctccggtgccagggacctccgggcgtggacctgtaccgcctggag
aagctgagttccagcaggtaccaggatcaggcagtcctcttcatcccggccatgaagaga
agtctggctggacgctaccgctgctcctaccagaacggaagcctctggtccctgcccagc
gaccagctggagctcgttgccacgggagtttttgccaaaccctcgctctcagcccagccc
ggcccggcggtgtcgtcaggaggggacgtaaccctacagtgtcagactcggtatggcttt
gaccaatttgctctgtacaaggaaggggaccctgcgccctacaagaatcccgagagatgg
tacagggctagttttcccatcatcacggtgaccgccgcccacagcggaacctaccgatgc
tacagcttctccagcagggacccatacctgtggtcagcccccagcgaccccctggagctt
gtggtcacaggaacctctgtgacccccagccggttaccaacagaaccaccttccccggta
gcagaattctcagaagccaccgctgaactgaccgtctcattcacaaacgaagtcttcaca
actgagacttctaggagtatcaccgccagtccaaaggagtcagactctccagctggtcct
gcccgccagtactacaccaagggcaacctggtccggatatgcctcggggctgtgatccta
ataatcctggcggggtttctggcagaggactggcacagccggaggaagcgcctgcggcac
aggggcagggctgtgcagaggccgcttccgcccctcccgcccctcccgctgacccggaaa
tcaaacgggggtcaggatggaggccgacaggatgttcacagccgcgggttatgttcatga

DBGET integrated database retrieval system