KEGG   Homo sapiens (human): 51218Help
Entry
51218             CDS       T01001                                 

Gene name
GLRX5, C14orf87, FLB4739, GRX5, PR01238, PRO1238, PRSA, SIDBA3, SPAHGC
Definition
(RefSeq) glutaredoxin 5
  KO
K07390  monothiol glutaredoxin
Organism
hsa  Homo sapiens (human)
Disease
H00982  Sideroblastic anemia
Brite
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   51218 (GLRX5)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    51218 (GLRX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 51218
NCBI-ProteinID: NP_057501
OMIM: 609588
HGNC: 20134
Ensembl: ENSG00000182512
Vega: OTTHUMG00000171636
Pharos: Q86SX6(Tbio)
UniProt: Q86SX6
Structure
PDB: 

Position
14q32.13
AA seq 157 aa AA seqDB search
MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKG
TPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
GCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggtccctcggccgagctgcggcggctctgctccgctgggggcgcggcgcgggc
ggcggtggcctttggggtccgggcgtgcgggcggcgggctcgggcgcgggcggcggcggc
tcggcggagcagttggacgcgctggtgaagaaggacaaggtggtggtcttcctcaagggg
acgccggagcagccccagtgcggcttcagcaacgccgtggtgcagatcctgcggctgcac
ggcgtccgcgattacgcggcctacaacgtgctggacgacccggagctccgacaaggcatt
aaagactattccaactggcccaccatcccgcaagtgtacctcaatggcgagtttgtaggg
ggctgtgacattcttctgcagatgcaccagaatggggacttggtggaagaactgaaaaag
ctggggatccactccgcccttttagatgaaaagaaagaccaagactccaagtga

DBGET integrated database retrieval system