KEGG   Homo sapiens (human): 51225Help
Entry
51225             CDS       T01001                                 

Gene name
ABI3, NESH, SSH3BP3
Definition
(RefSeq) ABI family member 3
  KO
K23710   
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Abi_HHR SH3_9 SH3_1 SH3_2
Motif
Other DBs
NCBI-GeneID: 51225
NCBI-ProteinID: NP_057512
OMIM: 606363
HGNC: 29859
Ensembl: ENSG00000108798
Vega: OTTHUMG00000161306
Pharos: Q9P2A4(Tdark)
UniProt: Q9P2A4
Position
17q21.32
AA seq 366 aa AA seqDB search
MAELQQLQEFEIPTGREALRGNHSALLRVADYCEDNYVQATDKRKALEETMAFTTQALAS
VAYQVGNLAGHTLRMLDLQGAALRQVEARVSTLGQMVNMHMEKVARREIGTLATVQRLPP
GQKVIAPENLPPLTPYCRRPLNFGCLDDIGHGIKDLSTQLSRTGTLSRKSIKAPATPASA
TLGRPPRIPEPVHLPVVPDGRLSAASSAFSLASAGSAEGVGGAPTPKGQAAPPAPPLPSS
LDPPPPPAAVEVFQRPPTLEELSPPPPDEELPLPLDLPPPPPLDGDELGLPPPPPGFGPD
EPSWVPASYLEKVVTLYPYTSQKDNELSFSEGTVICVTRRYSDGWCEGVSSEGTGFFPGN
YVEPSC
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctacagcagctgcaggagtttgagatccccactggccgggaggctctgagg
ggcaaccacagtgccctgctgcgggtcgctgactactgcgaggacaactatgtgcaggcc
acagacaagcggaaggcgctggaggagaccatggccttcactacccaggcactggccagc
gtggcctaccaggtgggcaacctggccgggcacactctgcgcatgttggacctgcagggg
gccgccctgcggcaggtggaagcccgtgtaagcacgctgggccagatggtgaacatgcat
atggagaaggtggcccgaagggagatcggcaccttagccactgtccagcggctgcccccc
ggccagaaggtcatcgccccagagaacctaccccctctcacgccctactgcaggagaccc
ctcaactttggctgcctggacgacattggccatgggatcaaggacctcagcacgcagctg
tcaagaacaggcaccctgtctcgaaagagcatcaaggcccctgccacacccgcctccgcc
accttggggagaccaccccggattcccgagccagtgcacctgccggtggtgcccgacggc
agactctccgccgcctcctctgcgttttccctggcctcggccggcagcgccgaaggtgtc
ggtggggcccccacgcccaaggggcaggcagcacctccagccccacctctccccagctcc
ttggacccacctcctccaccagcagccgtcgaggtgttccagcggcctcccacgctggag
gagttgtccccacccccaccggacgaagagctgcccctgccactggacctgcctcctcct
ccacccctggatggagatgaattggggctgcctccacccccaccaggatttgggcctgat
gagcccagctgggtgcctgcctcatacttggagaaagtggtgacactgtacccatacacc
agccagaaggacaatgagctctccttctctgagggcactgtcatctgtgtcactcgccgc
tactccgatggctggtgcgagggcgtcagctcagaggggactggattcttccctgggaac
tatgtggagcccagctgctga

DBGET integrated database retrieval system