KEGG   Homo sapiens (human): 51232
Entry
51232             CDS       T01001                                 
Symbol
CRIM1, CRIM-1, S52
Name
(RefSeq) cysteine rich transmembrane BMP regulator 1
  KO
K24518  cysteine-rich motor neuron 1 protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    51232 (CRIM1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Von Willebrand domain-containing proteins
  VWC domain-containing proteins
   51232 (CRIM1)
SSDB
Motif
Pfam: CRIM1_C VWC Antistasin IGFBP
Other DBs
NCBI-GeneID: 51232
NCBI-ProteinID: NP_057525
OMIM: 606189
HGNC: 2359
Ensembl: ENSG00000150938
Pharos: Q9NZV1(Tbio)
UniProt: Q9NZV1
Position
2:36355778..36551135
AA seq 1036 aa
MYLVAGDRGLAGCGHLLVSLLGLLLLLARSGTRALVCLPCDESKCEEPRNCPGSIVQGVC
GCCYTCASQRNESCGGTFGIYGTCDRGLRCVIRPPLNGDSLTEYEAGVCEDENWTDDQLL
GFKPCNENLIAGCNIINGKCECNTIRTCSNPFEFPSQDMCLSALKRIEEEKPDCSKARCE
VQFSPRCPEDSVLIEGYAPPGECCPLPSRCVCNPAGCLRKVCQPGNLNILVSKASGKPGE
CCDLYECKPVFGVDCRTVECPPVQQTACPPDSYETQVRLTADGCCTLPTRCECLSGLCGF
PVCEVGSTPRIVSRGDGTPGKCCDVFECVNDTKPACVFNNVEYYDGDMFRMDNCRFCRCQ
GGVAICFTAQCGEINCERYYVPEGECCPVCEDPVYPFNNPAGCYANGLILAHGDRWREDD
CTFCQCVNGERHCVATVCGQTCTNPVKVPGECCPVCEEPTIITVDPPACGELSNCTLTGK
DCINGFKRDHNGCRTCQCINTEELCSERKQGCTLNCPFGFLTDAQNCEICECRPRPKKCR
PIICDKYCPLGLLKNKHGCDICRCKKCPELSCSKICPLGFQQDSHGCLICKCREASASAG
PPILSGTCLTVDGHHHKNEESWHDGCRECYCLNGREMCALITCPVPACGNPTIHPGQCCP
SCADDFVVQKPELSTPSICHAPGGEYFVEGETWNIDSCTQCTCHSGRVLCETEVCPPLLC
QNPSRTQDSCCPQCTDQPFRPSLSRNNSVPNYCKNDEGDIFLAAESWKPDVCTSCICIDS
VISCFSESCPSVSCERPVLRKGQCCPYCIEDTIPKKVVCHFSGKAYADEERWDLDSCTHC
YCLQGQTLCSTVSCPPLPCVEPINVEGSCCPMCPEMYVPEPTNIPIEKTNHRGEVDLEVP
LWPTPSENDIVHLPRDMGHLQVDYRDNRLHPSEDSSLDSIASVVVPIIICLSIIIAFLFI
NQKKQWIPLLCWYRTPTKPSSLNNQLVSVDCKKGTRVQVDSSQRMLRIAEPDARFSGFYS
MQKQNHLQADNFYQTV
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgtacttggtggcgggggacagggggttggccggctgcgggcacctcctggtctcgctg
ctggggctgctgctgctgctggcgcgctccggcacccgggcgctggtctgcctgccctgt
gacgagtccaagtgcgaggagcccaggaactgcccggggagcatcgtgcagggcgtctgc
ggctgctgctacacgtgcgccagccagaggaacgagagctgcggcggcaccttcgggatt
tacggaacctgcgaccgggggctgcgttgtgtcatccgccccccgctcaatggcgactcc
ctcaccgagtacgaagcgggcgtttgcgaagatgagaactggactgatgaccaactgctt
ggttttaaaccatgcaatgaaaaccttattgctggctgcaatataatcaatgggaaatgt
gaatgtaacaccattcgaacctgcagcaatccctttgagtttccaagtcaggatatgtgc
ctttcagctttaaagagaattgaagaagagaagccagattgctccaaggcccgctgtgaa
gtccagttctctccacgttgtcctgaagattctgttctgatcgagggttatgctcctcct
ggggagtgctgtcccttacccagccgctgcgtgtgcaaccccgcaggctgtctgcgcaaa
gtctgccagccgggaaacctgaacatactagtgtcaaaagcctcagggaagccgggagag
tgctgtgacctctatgagtgcaaaccagttttcggcgtggactgcaggactgtggaatgc
cctcctgttcagcagaccgcgtgtcccccggacagctatgaaactcaagtcagactaact
gcagatggttgctgtactttgccaacaagatgcgagtgtctctctggcttatgtggtttc
cccgtgtgtgaggtgggatccactccccgcatagtctctcgtggcgatgggacacctgga
aagtgctgtgatgtctttgaatgtgttaatgatacaaagccagcctgcgtatttaacaat
gtggaatattatgatggagacatgtttcgaatggacaactgtcggttctgtcgatgccaa
gggggcgttgccatctgcttcaccgcccagtgtggtgagataaactgcgagaggtactac
gtgcccgaaggagagtgctgcccagtgtgtgaagatccagtgtatccttttaataatccc
gctggctgctatgccaatggcctgatccttgcccacggagaccggtggcgggaagacgac
tgcacattctgccagtgcgtcaacggtgaacgccactgcgttgcgaccgtctgcggacag
acctgcacaaaccctgtgaaagtgcctggggagtgttgccctgtgtgcgaagaaccaacc
atcatcacagttgatccacctgcatgtggggagttatcaaactgcactctgacagggaag
gactgcattaatggtttcaaacgcgatcacaatggttgtcggacctgtcagtgcataaac
accgaggaactatgttcagaacgtaaacaaggctgcaccttgaactgtcccttcggtttc
cttactgatgcccaaaactgtgagatctgtgagtgccgcccaaggcccaagaagtgcaga
cccataatctgtgacaagtattgtccacttggattgctgaagaataagcacggctgtgac
atctgtcgctgtaagaaatgtccagagctctcatgcagtaagatctgccccttgggtttc
cagcaggacagtcacggctgtcttatctgcaagtgcagagaggcctctgcttcagctggg
ccacccatcctgtcgggcacttgtctcaccgtggatggtcatcatcataaaaatgaggag
agctggcacgatgggtgccgggaatgctactgtctcaatggacgggaaatgtgtgccctg
atcacctgcccggtgcctgcctgtggcaaccccaccattcaccctggacagtgctgccca
tcatgtgcagatgactttgtggtgcagaagccagagctcagtactccctccatttgccac
gcccctggaggagaatactttgtggaaggagaaacgtggaacattgactcctgtactcag
tgcacctgccacagcggacgggtgctgtgtgagacagaggtgtgcccaccgctgctctgc
cagaacccctcacgcacccaggattcctgctgcccacagtgtacagatcaaccttttcgg
ccttccttgtcccgcaataacagcgtacctaattactgcaaaaatgatgaaggggatata
ttcctggcagctgagtcctggaagcctgacgtttgtaccagctgcatctgcattgatagc
gtaattagctgtttctctgagtcctgcccttctgtatcctgtgaaagacctgtcttgaga
aaaggccagtgttgtccctactgcatagaagacacaattccaaagaaggtggtgtgccac
ttcagtgggaaggcctatgccgacgaggagcggtgggaccttgacagctgcacccactgc
tactgcctgcagggccagaccctctgctcgaccgtcagctgcccccctctgccctgtgtt
gagcccatcaacgtggaaggaagttgctgcccaatgtgtccagaaatgtatgtcccagaa
ccaaccaatatacccattgagaagacaaaccatcgaggagaggttgacctggaggttccc
ctgtggcccacgcctagtgaaaatgatatcgtccatctccctagagatatgggtcacctc
caggtagattacagagataacaggctgcacccaagtgaagattcttcactggactccatt
gcctcagttgtggttcccataattatatgcctctctattataatagcattcctattcatc
aatcagaagaaacagtggataccactgctttgctggtatcgaacaccaactaagccttct
tccttaaataatcagctagtatctgtggactgcaagaaaggaaccagagtccaggtggac
agttcccagagaatgctaagaattgcagaaccagatgcaagattcagtggcttctacagc
atgcaaaaacagaaccatctacaggcagacaatttctaccaaacagtgtga

DBGET integrated database retrieval system