KEGG   Homo sapiens (human): 51241
Entry
51241             CDS       T01001                                 

Gene name
COX16, C14orf112, HSPC203, hCOX16
Definition
(RefSeq) cytochrome c oxidase assembly factor COX16
  KO
K18182  cytochrome c oxidase assembly protein subunit 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    51241 (COX16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    51241 (COX16)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    51241 (COX16)
SSDB
Motif
Pfam: COX16 TubC_N
Other DBs
NCBI-GeneID: 51241
NCBI-ProteinID: NP_057552
OMIM: 618064
HGNC: 20213
Ensembl: ENSG00000133983
Vega: OTTHUMG00000171238
Pharos: Q9P0S2(Tdark)
UniProt: Q9P0S2
Position
14q24.2
AA seq 106 aa
MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENK
ISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT
NT seq 321 nt   +upstreamnt  +downstreamnt
atgtttgcacccgcggtgatgcgtgcttttcgcaagaacaagactctcggctatggagtc
cccatgttgttgctgattgttggaggttcttttggtcttcgtgagttttctcaaatccga
tatgatgctgtgaagagtaaaatggatcctgagcttgaaaaaaaactgaaagagaataaa
atatctttagagtcggaatatgagaaaatcaaagactccaagtttgatgactggaagaat
attcgaggacccaggccttgggaagatcctgacctcctccaaggaagaaatccagaaagc
cttaagactaagacaacttga

DBGET integrated database retrieval system