KEGG   Homo sapiens (human): 5125Help
Entry
5125              CDS       T01001                                 

Gene name
PCSK5, PC5, PC6, PC6A, SPC6
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 5
  KO
K08654  proprotein convertase subtilisin/kexin type 5 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5125 (PCSK5)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    5125 (PCSK5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     5125 (PCSK5)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S8: subtilisin family
   5125 (PCSK5)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Subtilisin family
   5125 (PCSK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 Furin-like_2 GF_recep_IV P_proprotein S8_pro-domain VSP Furin-like
Motif
Other DBs
NCBI-GeneID: 5125
NCBI-ProteinID: NP_001177411
OMIM: 600488
HGNC: 8747
Ensembl: ENSG00000099139
Vega: OTTHUMG00000020039
Pharos: Q92824(Tchem)
UniProt: Q92824
Position
9q21.13
AA seq 1860 aa AA seqDB search
MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFI
NIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSR
AQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPD
LMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIG
GVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGR
RGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEECSSTLATTYS
SGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSR
AGHLNANDWKTNAAGFKVSHLYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIR
PNSAVRSIYKASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPSGTRSQLLANR
LFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSV
QPYSPTNEFPKVERFRYSRVEDPTDDYGTEDYAGPCDPECSEVGCDGPGPDHCNDCLHYY
YKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSHGDQCMSCKYGYFLNEETNSC
VTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVSCEDGRYFNGQ
DCQPCHRFCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDI
SCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKDGEYVDEHGHCQTCEASCAKCQGPTQ
EDCTTCPMTRIFDDGRCVSNCPSWKFEFENQCHPCHHTCQRCQGSGPTHCTSCGADNYGR
EHFLYQGECGDSCPEGHYATEGNTCLPCPDNCELCHSVHVCTRCMKGYFIAPTNHTCQKL
ECGQGEVQDPDYEECVPCEEGCLGCSLDDPGTCTSCAMGYYRFDHHCYKTCPEKTYSEEV
ECKACDSNCGSCDQNGCYWCEEGFFLLGGSCVRKCGPGFYGDQEMGECESCHRACETCTG
PGHDECSSCQEGLQLLRGMCVHATKTQEEGKFWNDILRKLQPCHSSCKTCNGSATLCTSC
PKGAYLLAQACVSSCPQGTWPSVRSGSCENCTEACAICSGADLCKKCQMQPGHPLFLHEG
RCYSKCPEGSYAEDGICERCSSPCRTCEGNATNCHSCEGGHVLHHGVCQENCPERHVAVK
GVCKHCPEMCQDCIHEKTCKECTPEFFLHDDMCHQSCPRGFYADSRHCVPCHKDCLECSG
PKADDCELCLESSWVLYDGLCLEECPAGTYYEKETKECRDCHKSCLTCSSSGTCTTCQKG
LIMNPRGSCMANEKCSPSEYWDEDAPGCKPCHVKCFHCMGPAEDQCQTCPMNSLLLNTTC
VKDCPEGYYADEDSNRCAHCHSSCRTCEGRHSRQCHSCRPGWFQLGKECLLQCREGYYAD
NSTGRCERCNRSCKGCQGPRPTDCLSCDRFFFLLRSKGECHRSCPDHYYVEQSTQTCERC
HPTCDQCKGKGALNCLSCVWSYHLMGGICTSDCLVGEYRVGEGEKFNCEKCHESCMECKG
PGAKNCTLCPANLVLHMDDSHCLHCCNTSDPPSAQECCDCQDTTDECILRTSKVRPATEH
FKTALFITSSMMLVLLLGAAVVVWKKSRGRVQPAAKAGYEKLADPNKSYSSYKSSYREST
SFEEDQVIEYRDRDYDEDDDDDIVYMGQDGTVYRKFKYGLLDDDDIDELEYDDESYSYYQ
NT seq 5583 nt NT seq  +upstreamnt  +downstreamnt
atgggctgggggagccgctgctgctgcccgggacgtttggacctgctgtgcgtgctggcg
ctgctcgggggctgcctgctccccgtgtgtcggacgcgcgtctacaccaaccactgggca
gtcaaaatcgccgggggcttcccggaggccaaccgtatcgccagcaagtacggattcatc
aacataggacagataggggccctgaaggactactaccacttctaccatagcaggacgatt
aaaaggtcagttatctcgagcagagggacccacagtttcatttcaatggaaccaaaggtg
gaatggatccaacagcaagtggtaaaaaagcggacaaagagggattatgacttcagtcgt
gcccagtctacctatttcaatgatcccaagtggcccagcatgtggtatatgcactgcagt
gacaatacacatccctgccagtctgacatgaatatcgaaggagcctggaagagaggctac
acgggaaagaacattgtggtcactatcctggatgacggaattgagagaacccatccagat
ctgatgcaaaactacgatgctctggcaagttgcgacgtgaatgggaatgacttggaccca
atgcctcgttatgatgcaagcaacgagaacaagcatgggactcgctgtgctggagaagtg
gcagccgctgcaaacaattcgcactgcacagtcggaattgctttcaacgccaagatcgga
ggagtgcgaatgctggacggagatgtcacggacatggttgaagcaaaatcagttagcttc
aacccccagcacgtgcacatttacagcgccagctggggcccggatgatgatggcaagact
gtggacggaccagcccccctcacccggcaagcctttgaaaacggcgttagaatggggcgg
agaggcctcggctctgtgtttgtttgggcatctggaaatggtggaaggagcaaagaccac
tgctcctgtgatggctacaccaacagcatctacaccatctccatcagcagcactgcagaa
agcggaaagaaaccttggtacctggaagagtgttcatccacgctggccacaacctacagc
agcggggagtcctacgataagaaaatcatcactacagatctgaggcagcgttgcacggac
aaccacactgggacgtcagcctcagcccccatggctgcaggcatcattgcgctggccctg
gaagccaatccgtttctgacctggagagacgtacagcatgttattgtcaggacttcccgt
gcgggacatttgaacgctaatgactggaaaaccaatgctgctggttttaaggtgagccat
ctttatggatttggactgatggacgcagaagccatggtgatggaggcagagaagtggacc
accgttccccggcagcacgtgtgtgtggagagcacagaccgacaaatcaagacaatccgc
cctaacagtgcagtgcgctccatctacaaagcttcaggctgctcggataaccccaaccgc
catgtcaactacctggagcacgtcgttgtgcgcatcaccatcacccaccccaggagagga
gacctggccatctacctgacctcgccctctggaactaggtctcagcttttggccaacagg
ctatttgatcactccatggaaggattcaaaaactgggagttcatgaccattcattgctgg
ggagaaagagctgctggtgactgggtccttgaagtttatgatactccctctcagctaagg
aactttaagactccaggtaaattgaaagaatggtctttggtcctctacggcacctccgtg
cagccatattcaccaaccaatgaatttccgaaagtggaacggttccgctatagccgagtt
gaagaccccacagacgactatggcacagaggattatgcaggtccctgcgaccctgagtgc
agtgaggttggctgtgacgggccaggaccagaccactgcaatgactgtttgcactactac
tacaagctgaaaaacaataccaggatctgtgtctccagctgcccccctggccactaccac
gccgacaagaagcgctgcaggaagtgtgcccccaactgtgagtcctgctttgggagccat
ggtgaccaatgcatgtcctgcaaatatggatactttctgaatgaagaaaccaacagctgt
gttactcactgccctgatgggtcatatcaggataccaagaaaaatctttgccggaaatgc
agtgaaaactgcaagacatgtactgaattccataactgtacagaatgtagggatgggtta
agcctgcagggatcccggtgctctgtctcctgtgaagatggacggtatttcaacggccag
gactgccagccctgccaccgcttctgcgccacttgtgctggggcaggagctgatgggtgc
attaactgcacagagggctacttcatggaggatgggagatgcgtgcagagctgtagtatc
agctattactttgaccactcttcagagaatggatacaaatcctgcaaaaaatgtgatatc
agttgtttgacgtgcaatggcccaggattcaagaactgtacaagctgccctagtgggtat
ctcttagacttaggaatgtgtcaaatgggagccatttgcaaggatggagaatatgttgat
gagcatggccactgccagacctgtgaggcctcatgtgccaagtgccagggaccaacccag
gaagactgcactacctgccccatgacaaggatttttgatgatggccgctgtgtttcgaac
tgcccctcatggaaatttgaatttgagaaccaatgccatccatgccaccacacctgccag
agatgccaaggaagtggccctacccactgcacctcctgtggagcagacaactatggccga
gagcacttcctgtaccagggagagtgtggagatagctgcccagagggccactatgccact
gaggggaacacctgcctgccctgcccagacaactgtgagctttgccacagcgtgcatgtc
tgcacaagatgcatgaagggctacttcatagcgcccaccaaccacacatgccagaagtta
gagtgtggacaaggtgaagtccaagacccagactatgaagaatgtgtcccttgtgaagaa
ggatgtctgggatgcagcttggatgatccaggaacatgtacatcttgcgctatggggtat
tacaggtttgatcaccattgttataaaacctgtcctgagaagacctacagtgaggaagtg
gaatgcaaggcgtgtgatagtaactgtggcagctgtgaccagaatgggtgttactggtgt
gaagagggcttctttctcttaggtggcagttgtgtgaggaaatgtggtcctggattctat
ggtgaccaagaaatgggagaatgtgagtcctgccaccgagcatgcgaaacctgcacaggc
cctggtcatgacgagtgcagcagctgccaggaaggactgcagctgctgcgtgggatgtgc
gtgcatgccaccaagacccaggaggagggcaaattctggaatgatattttgagaaaactc
cagccttgtcattcttcttgtaaaacctgcaatggatctgcaactctgtgcacttcatgt
cccaaaggtgcatatcttctggctcaggcctgtgtttcctcctgtccccaaggcacatgg
ccttccgtaaggagtgggagctgcgagaactgtacggaggcctgtgccatctgctctgga
gccgatctttgcaaaaaatgccagatgcagccgggccaccctctcttcctccatgaaggc
aggtgctactccaagtgcccggagggctcttatgcagaagacggcatatgtgaacgctgt
agctctccttgcagaacatgtgaaggaaacgccaccaactgccattcttgtgaaggaggc
cacgtcctgcaccacggagtgtgccaggaaaactgccccgagaggcacgtggctgtgaag
ggggtatgcaagcattgcccagagatgtgtcaggactgcatccatgagaaaacatgcaaa
gagtgcacgcctgagttcttcctgcacgatgatatgtgccaccagtcctgtccccgtggc
ttctatgcagactcgcgccactgtgtcccctgccataaagactgtctggagtgcagtggc
cccaaagccgacgactgcgagctctgtcttgagagttcctgggtcctctatgatggactg
tgcttggaggagtgtccagcaggaacctattatgaaaaggagactaaggagtgcagagat
tgccacaagtcctgcttgacctgctcatcatctgggacctgcaccacctgtcagaaaggc
ctgatcatgaaccctcgtgggagctgcatggccaacgagaagtgctcaccctccgagtac
tgggatgaggatgctcccgggtgcaagccctgccatgttaagtgcttccactgcatgggg
ccggcggaggaccagtgtcaaacatgccccatgaacagccttcttctcaacacaacctgt
gtgaaggactgcccagagggctattatgccgatgaggacagcaaccggtgtgcccactgc
cacagctcttgcaggacatgtgaagggagacacagcaggcagtgccactcctgccgaccg
ggctggttccagctaggaaaagagtgcctgctccagtgcagggaaggatattacgcagac
aactccactggccggtgtgagaggtgcaacaggagctgcaaggggtgccagggcccacgg
cccacagactgcctgtcttgcgatagatttttctttctgctccgctccaaaggagagtgt
catcgctcctgcccagaccattactatgtagagcaaagcacacagacctgtgagagatgc
catccgacttgtgatcaatgcaaaggaaaaggagcgttgaattgtttatcctgtgtgtgg
agttaccacctcatgggagggatctgcacctcggactgtcttgtgggggaatacagagtg
ggagagggagagaagtttaactgtgaaaaatgccacgagagctgcatggaatgcaaggga
ccaggggccaagaactgcaccttgtgccctgccaacctggtgctgcacatggacgacagc
cactgcctccactgctgcaacacctctgatccccccagtgcccaggagtgctgtgactgc
caggacaccacggacgaatgcatccttcgaacaagcaaggttaggcctgcaactgagcat
ttcaagacagctctgttcatcacctcctccatgatgctggtgcttctgctcggggcagct
gtggtagtgtggaagaaatctcgtggccgagtccagccagcagcaaaggccggctatgaa
aaactggccgaccccaacaagtcttactcctcctataagagcagctatagagagagcacc
agctttgaagaggatcaggtgattgagtacagggatcgggactatgatgaggatgatgat
gatgacatcgtctacatgggccaggatggcacagtctaccggaaatttaaatatgggctg
ctggatgacgatgacatagatgagctggaatatgatgacgagagttactcctactaccag
taa

DBGET integrated database retrieval system