KEGG   Homo sapiens (human): 51251Help
Entry
51251             CDS       T01001                                 

Gene name
NT5C3A, NT5C3, P5'N-1, P5N-1, PN-I, POMP, PSN1, UMPH, UMPH1, cN-III, hUMP1, p36
Definition
(RefSeq) 5'-nucleotidase, cytosolic IIIA
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Disease
H00674  Anemia due to disorders of nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    51251 (NT5C3A)
   00240 Pyrimidine metabolism
    51251 (NT5C3A)
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    51251 (NT5C3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     51251 (NT5C3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UMPH-1 HAD zf-ANAPC11 CIDE-N DUF3180
Motif
Other DBs
NCBI-GeneID: 51251
NCBI-ProteinID: NP_001002010
OMIM: 606224
HGNC: 17820
Ensembl: ENSG00000122643
Vega: OTTHUMG00000152983
Pharos: Q9H0P0(Tbio)
UniProt: Q9H0P0
Structure
PDB: 

Position
7p14.3
AA seq 331 aa AA seqDB search
MDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSVRIKNP
TRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLL
QLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGY
ENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGE
LIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVD
ELLEKYMDSYDIVLVQDESLEVANSILQKIL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgcggccgtggcgagggtgggcgcggtagcgagcgccagcgtgtgcgccctg
gtggcgggggtggtgctggctcagtacatattcaccttgaagaggaagacggggcggaag
accaagatcatcgagatgatgccagaattccagaaaagttcagttcgaatcaagaaccct
acaagagtagaagaaattatctgtggtcttatcaaaggaggagctgccaaacttcagata
ataacggactttgatatgacactcagtagattttcatataaagggaaaagatgcccaaca
tgtcataatatcattgacaactgtaagctggttacagatgaatgtagaaaaaagttattg
caactaaaggaaaaatattacgctattgaagttgatcctgttcttactgtagaagagaag
tacccttatatggtggaatggtatactaaatcacatggtttgcttgttcagcaagcttta
ccaaaagctaaacttaaagaaattgtggcagaatctgacgttatgctcaaagaaggatat
gagaatttctttgataagctccaacaacatagcatccccgtgttcatattttcggctgga
atcggcgatgtactagaggaagttattcgtcaagctggtgtttatcatcccaatgtcaaa
gttgtgtccaattttatggattttgatgaaactggggtgctcaaaggatttaaaggagaa
ctaattcatgtatttaacaaacatgatggtgccttgaggaatacagaatatttcaatcaa
ctaaaagacaatagtaacataattcttctgggagactcccaaggagacttaagaatggca
gatggagtggccaatgttgagcacattctgaaaattggatatctaaatgatagagtggat
gagcttttagaaaagtacatggactcttatgatattgttttagtacaagatgaatcatta
gaagtagccaactctattttacagaagattctataa

DBGET integrated database retrieval system