KEGG   Homo sapiens (human): 51251
Entry
51251             CDS       T01001                                 
Symbol
NT5C3A, NT5C3, P5'N-1, P5N-1, PN-I, POMP, PSN1, UMPH, UMPH1, cN-III, hUMP1, p36
Name
(RefSeq) 5'-nucleotidase, cytosolic IIIA
  KO
K24242  7-methylguanosine nucleotidase [EC:3.1.3.91]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
Disease
H00674  Anemia due to disorders of nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    51251 (NT5C3A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.91  7-methylguanosine nucleotidase
     51251 (NT5C3A)
SSDB
Motif
Pfam: UMPH-1 HAD zf-ANAPC11 T6PP_C CIDE-N NMB0315_dom_I Hydrolase
Other DBs
NCBI-GeneID: 51251
NCBI-ProteinID: NP_001002010
OMIM: 606224
HGNC: 17820
Ensembl: ENSG00000122643
UniProt: Q9H0P0
Position
7:complement(33014113..33062776)
AA seq 331 aa
MDRAAVARVGAVASASVCALVAGVVLAQYIFTLKRKTGRKTKIIEMMPEFQKSSVRIKNP
TRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLL
QLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGY
ENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGE
LIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVD
ELLEKYMDSYDIVLVQDESLEVANSILQKIL
NT seq 996 nt   +upstreamnt  +downstreamnt
atggaccgcgcggccgtggcgagggtgggcgcggtagcgagcgccagcgtgtgcgccctg
gtggcgggggtggtgctggctcagtacatattcaccttgaagaggaagacggggcggaag
accaagatcatcgagatgatgccagaattccagaaaagttcagttcgaatcaagaaccct
acaagagtagaagaaattatctgtggtcttatcaaaggaggagctgccaaacttcagata
ataacggactttgatatgacactcagtagattttcatataaagggaaaagatgcccaaca
tgtcataatatcattgacaactgtaagctggttacagatgaatgtagaaaaaagttattg
caactaaaggaaaaatattacgctattgaagttgatcctgttcttactgtagaagagaag
tacccttatatggtggaatggtatactaaatcacatggtttgcttgttcagcaagcttta
ccaaaagctaaacttaaagaaattgtggcagaatctgacgttatgctcaaagaaggatat
gagaatttctttgataagctccaacaacatagcatccccgtgttcatattttcggctgga
atcggcgatgtactagaggaagttattcgtcaagctggtgtttatcatcccaatgtcaaa
gttgtgtccaattttatggattttgatgaaactggggtgctcaaaggatttaaaggagaa
ctaattcatgtatttaacaaacatgatggtgccttgaggaatacagaatatttcaatcaa
ctaaaagacaatagtaacataattcttctgggagactcccaaggagacttaagaatggca
gatggagtggccaatgttgagcacattctgaaaattggatatctaaatgatagagtggat
gagcttttagaaaagtacatggactcttatgatattgttttagtacaagatgaatcatta
gaagtagccaactctattttacagaagattctataa

DBGET integrated database retrieval system