KEGG   Homo sapiens (human): 51252
Entry
51252             CDS       T01001                                 
Symbol
FAM178B
Name
(RefSeq) family with sequence similarity 178 member B
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CANIN
Other DBs
NCBI-GeneID: 51252
NCBI-ProteinID: NP_001116118
HGNC: 28036
Ensembl: ENSG00000168754
Pharos: Q8IXR5(Tdark)
UniProt: Q8IXR5 B3KV66
Position
2:complement(96875885..96986580)
AA seq 679 aa
MWPRLPGAGLAPQLRRQDQRLHFTGQMSHGLQMAGPQETVLALPLREGVQAAATVPILLY
NLEDGLSDHPLDQGPRCPARRPCSPASAPAPTSPKKPKIQAPGETFPTDWSPPPVEFLNP
RVLQASREAPAQRWVGVVGPQGLRRLAGELPEELEQEHLDLDPKRGLALPEKLFWNTSGL
SQQAAAPEFSWGGSGSYFNNLDYLLQEKREQALEQERERLLLQECLNLNSLDLDEEEVPL
TPEHRMLVEKYSVSLQTIPPVHPGETVFLPRCHPLPCILDSSLLKPRSHLEGLFLSSPPA
QQLSFLRSGLLNILYLHMPDCPVSLLQWLFQLLTWPPETSLGAFGLLWDLIVDGIFLQPD
EDKHLWCPSLQEVREAFHSLGAHSPALYPLGPFWHGGRVLPGEAGLNENEEQDAPQEIAL
DISLGHIYKFLALCAQAQPGAYTDENLMGLIELLCRTSLDVGLRLLPKVDLQQLLLLLLE
NIREWPGKLQELCCTLSWVSDHHHNLLALVQFFPDMTSRSRRLRSQLSLVVIARMLGQQE
MLPLWQEKTQLSSLSRLLGLMRPSSLRQYLDSVPLPPCQEQQPKASAELDHKACYLCHSL
LMLAGVVVSCQDITPDQWGELQLLCMQLDRHISTQIRESPQAMHRTMLKDLATQTYIRWQ
ELLTHCQPQAQYFSPWKDI
NT seq 2040 nt   +upstreamnt  +downstreamnt
atgtggccaaggcttccaggtgcgggcctcgctccacaactcaggaggcaggatcagcgg
ctccattttacaggacagatgtcccacggcttgcagatggctgggccccaggagacggtg
ctagcccttcctctgagagaaggggtgcaggctgccgccaccgtgcccatcctcctgtac
aacctggaggatggcttgtcagaccatcccctggaccaggggccccgctgccctgcccgg
cggccctgcagccctgcctcggctccagctcccacatcgccaaagaagcccaagatacag
gcacctggggaaacgtttcccactgactggagccccccgcccgtggaattcctcaacccg
agggtgctgcaggccagtcgggaggccccggcccagaggtgggtgggtgtggtgggcccc
cagggcctgaggagactggctggtgagctgcccgaggagttggagcaggaacacctggac
ttggacccgaagaggggcctggccttgccagagaagctgttctggaacacgtcaggcctg
agccagcaggctgcggccccagagttttcctgggggggctcaggaagctacttcaacaac
ctggactacttactgcaggagaagagggaacaggccctggagcaggagcgagagaggctg
cttctgcaggagtgtctcaatctcaactccttggatcttgatgaagaggaagtgccactc
acacccgagcacaggatgctggtggaaaagtactcagtgtccctgcagaccatcccgccg
gtccatccaggtgagactgtgtttctgcccaggtgtcaccccctgccatgcatcctggac
tcctcactcctgaagccacgcagccacctggaagggctgttcctcagctccccgccagcc
caacagctctccttcctgcgcagtggcctcctgaacatcctctacctgcacatgcctgac
tgcccggtatccctgctccagtggctgttccagctgctgacatggcctccagaaacatct
ttgggagcctttggtcttctgtgggatctcattgtggatggaatcttccttcagcctgat
gaagacaagcacctgtggtgcccctcactgcaagaagtcagggaggcattccacagcctg
ggtgcccacagtcctgccctgtaccctctggggcccttttggcacggtggcagggtgctt
ccaggcgaggctggcctgaatgagaatgaggagcaggacgctccccaagagattgccttg
gacatcagcctgggccacatctacaagtttctggcgctgtgtgcccaggcccagccgggg
gcctacactgatgagaacctcatgggactgattgagctgctgtgccgcaccagcctggac
gtggggctccgcctgctgcccaaagttgacctccagcagcttctcctcttgctcctggag
aacatccgggagtggccagggaagctccaggaactgtgctgcaccctgagctgggtgtct
gaccaccaccacaacctgctggccctcgtgcagttcttcccagacatgacctcccggagc
aggcggcttcgaagccagctcagccttgtggtcattgctcgaatgctgggccagcaggag
atgctccctctctggcaagagaagacccagctgtcctcgctcagccggctcctgggcctc
atgaggccatcatctctcaggcaatacctggactctgtgcccttgccaccctgccaggag
caacagccaaaggctagtgccgagctagaccacaaggcctgctacctgtgccacagcttg
ctgatgctggccggggtagttgttagctgccaggacatcactccagaccagtggggcgag
ctgcagctgctgtgcatgcagttggaccgccacatcagcacgcagatccgggagagcccc
caggccatgcaccgcaccatgctcaaggacctggctacccagacctacatccgttggcag
gagctgctgacccactgccagccccaggcccagtatttcagcccctggaaagacatctaa

DBGET integrated database retrieval system