KEGG   Homo sapiens (human): 51260Help
Entry
51260             CDS       T01001                                 

Gene name
PBDC1, CXorf26
Definition
(RefSeq) polysaccharide biosynthesis domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Polysacc_synt_4
Motif
Other DBs
NCBI-GeneID: 51260
NCBI-ProteinID: NP_057584
HGNC: 28790
Ensembl: ENSG00000102390
Vega: OTTHUMG00000021876
Pharos: Q9BVG4(Tdark)
UniProt: Q9BVG4
Position
Xq13.3
AA seq 233 aa AA seqDB search
MAATSGTDEPVSGELVSVAHALSLPAESYGNDPDIEMAWAMRAMQHAEVYYKLISSVDPQ
FLKLTKVDDQIYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL
LRLDCSQGYTEENTIFAPRIQFFAIEIARNREGYNKAVYISVQDKEGEKGVNNGGEKRAD
SGEEENTKNGGEKGADSGEEKEEGINREDKTDKGGEKGKEADKEINKSGEKAM
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccagtggaactgatgagccggtttccggggagttggtgtctgtggcacat
gcgctttctctcccagcagagtcgtatggcaacgatcctgacattgagatggcttgggcc
atgagagcaatgcagcatgctgaagtctattacaagctgatttcatcagttgacccacag
ttcctgaaactcaccaaagtagatgaccaaatttactctgagttccggaaaaattttgag
acccttaggatagatgtgttggacccagaagaactcaagtcagaatcagccaaagagaag
tggaggccattctgcttgaagtttaatgggattgttgaagacttcaactatggtactttg
ctgcgactagattgttctcagggctacactgaggaaaacaccatctttgcccccaggata
caattctttgccattgaaattgctcggaaccgggaaggctataacaaagctgtttatatc
agtgttcaggacaaagaaggagagaaaggagtcaacaatggaggagaaaaaagagctgac
agtggagaagaagagaacaccaagaatggaggagagaaaggagctgatagtggagaagaa
aaagaggaaggaatcaacagagaagacaaaactgacaaaggaggagaaaaagggaaagaa
gctgacaaagaaatcaacaaaagtggtgaaaaagctatgtaa

DBGET integrated database retrieval system