KEGG   Homo sapiens (human): 51263
Entry
51263             CDS       T01001                                 

Gene name
MRPL30, L28MT, L30MT, MRP-L28, MRP-L30, MRPL28, MRPL28M, RPML28
Definition
(RefSeq) mitochondrial ribosomal protein L30
  KO
K02907  large subunit ribosomal protein L30
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    51263 (MRPL30)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    51263 (MRPL30)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    51263 (MRPL30)
  Bacteria
    51263 (MRPL30)
  Archaea
    51263 (MRPL30)
SSDB
Motif
Pfam: Ribosomal_L30
Other DBs
NCBI-GeneID: 51263
NCBI-ProteinID: NP_660213
OMIM: 611838
HGNC: 14036
Ensembl: ENSG00000185414
Vega: OTTHUMG00000130642
Pharos: Q8TCC3(Tdark)
UniProt: Q8TCC3
Structure
PDB: 
5OOM 5OOL 3J7Y

Position
2q11.2
AA seq 161 aa
MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDP
QNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIK
PLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES
NT seq 486 nt   +upstreamnt  +downstreamnt
atggctgggattttgcgcttagtagttcaatggcccccaggcagactacagactgtgaca
aaaggtgtggagtctcttatttgtacagattggattcgtcacaaattcaccagatcaaga
attccagaaaaagtgtttcaggcctcacctgaagatcatgaaaaatacggtggggatcca
cagaaccctcataaactgcatattgttaccagaataaaaagtacaagaagacgtccatat
tgggaaaaagatataataaagatgcttggattagaaaaagcacatacccctcaagttcac
aagaatatcccttcagtgaatgcaaaattgaaagtagttaagcatttgataagaatcaag
cccttgaagttgccacaaggacttccagcagaggagaacatgtctaacacgtgcctcaaa
agcactggggagttagtagtgcagtggcatctgaaacctgtggagcagaaagcacatgag
tcctaa

DBGET integrated database retrieval system