KEGG   Homo sapiens (human): 51265
Entry
51265             CDS       T01001                                 

Gene name
CDKL3, NKIAMRE
Definition
(RefSeq) cyclin dependent kinase like 3
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    51265 (CDKL3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     51265 (CDKL3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   51265 (CDKL3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo FTA2 RIO1 MdcG APH
Other DBs
NCBI-GeneID: 51265
NCBI-ProteinID: NP_001107047
OMIM: 608459
HGNC: 15483
Ensembl: ENSG00000006837
Vega: OTTHUMG00000186341
Pharos: Q8IVW4(Tbio)
UniProt: Q8IVW4
Structure
PDB: 
3ZDU

Position
5q31.1
AA seq 592 aa
MEMYETLGKVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAMREIKFLKQFHHE
NLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIDYLHSNN
IIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIYTDYVATRWYRAPELVLKDTSYGK
PVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLSPHLQNIFSKSPIFAGVVLP
QVQHPKNARKKYPKLNGLLADIVHACLQIDPADRISSSDLLHHEYFTRDGFIEKFMPELK
AKLLQEAKVNSLIKPKESSKENELRKDERKTVYTNTLLSSSVLGKEIEKEKKPKEIKVRV
IKVKGGRGDISEPKKKEYEGGLGQQDANENVHPMSPDTKLVTIEPPNPINPSTNCNGLKE
NPHCGGSVTMPPINLTNSNLMAANLSSNLFHPSVRLTERAKKRRTSSQSIGQVMPNSRQE
DPGPIQSQMEKGIFNERTGHSDQMANENKRKLNFSRSDRKEFHFPELPVTIQSKDTKGME
VKQIKMLKRESKKTESSKIPTLLNVDQNQEKQEGGDGHCEGKNLKRNRFFFW
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggagatgtatgaaacccttggaaaagtgggagagggaagttacggaacagtcatgaaa
tgtaaacataagaatactgggcagatagtggccattaagatattttatgagagaccagaa
caatctgtcaacaaaattgcgatgagagaaataaagtttctaaagcaatttcatcacgaa
aacctggtcaatctgattgaagtttttagacagaaaaagaaaattcatttggtatttgaa
tttattgaccacacagtattagatgagttacaacattattgtcatggactagagagtaag
cgacttagaaaatacctcttccagatccttcgagcaattgactatcttcacagtaataat
atcattcatcgagatataaaacctgagaatattttagtatcccagtcaggaattactaag
ctctgtgattttggttttgcacgaacactagcagctcctggggacatttatacggactat
gtggccacacgctggtatagagctcccgaattagtattaaaagatacttcttatggaaaa
cctgtggatatctgggctttgggctgtatgatcattgagatggccactggaaatccctat
cttcctagtagttctgatttggatttactccataaaattgttttgaaagtgggcaatttg
tcacctcacttgcagaatatcttttccaagagccccatttttgctggggtagttcttcct
caagttcaacaccccaaaaatgcaagaaaaaaatatccaaagcttaatggattgttggca
gatatagttcatgcttgtttacaaattgatcctgctgacaggatatcatctagtgatctt
ttgcatcatgagtattttactagagatggatttattgaaaaattcatgccagaactgaaa
gctaaattactgcaggaagcaaaagtcaattcattaataaagccaaaagagagttctaaa
gaaaatgaactcaggaaagatgaaagaaaaacagtttataccaatacactgctaagtagt
tcagttttgggaaaggaaatagaaaaagagaaaaagcccaaggagatcaaagtcagagtt
attaaagtcaaaggaggaagaggagatatctcagaaccaaaaaagaaagagtatgaaggt
ggacttggtcaacaggatgcaaatgaaaatgttcatcctatgtctccagatacaaaactt
gtaaccattgaaccaccaaaccctatcaatcccagcactaactgtaatggcttgaaagaa
aatccacattgcggaggttctgtgacaatgccacccatcaatctaactaacagtaatttg
atggctgcaaatctcagttcaaatctctttcaccccagtgtgaggttaactgaaagagca
aaaaagagacgcacttcttcacaatctattggacaagttatgcctaatagcaggcaagag
gatccaggtcctattcaaagccaaatggagaagggtatatttaatgagcgaacaggtcac
agtgaccaaatggcaaatgagaacaaaaggaagctgaatttttccagatctgacaggaaa
gaattccattttccagaattgcctgtcacaatacagtcaaaagatacaaaaggaatggaa
gttaaacagataaaaatgctgaagagggagtcaaagaaaacagagtcatctaagatacca
actttacttaacgtggatcaaaatcaagaaaaacaagagggtggagatggccattgcgag
gggaagaatttgaagagaaacaggttttttttctggtag

DBGET integrated database retrieval system