KEGG   Homo sapiens (human): 51267
Entry
51267             CDS       T01001                                 
Symbol
CLEC1A, CLEC-1, CLEC1
Name
(RefSeq) C-type lectin domain family 1 member A
  KO
K10069  C-type lectin domain family 1 member A
Organism
hsa  Homo sapiens (human)
Disease
H01328  Aspergillosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    51267 (CLEC1A)
   04091 Lectins [BR:hsa04091]
    51267 (CLEC1A)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   51267 (CLEC1A)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   51267 (CLEC1A)
SSDB
Motif
Pfam: Lectin_C Ly49 KLRAQ INV_N
Other DBs
NCBI-GeneID: 51267
NCBI-ProteinID: NP_057595
OMIM: 606782
HGNC: 24355
Ensembl: ENSG00000150048
Pharos: Q8NC01(Tbio)
UniProt: Q8NC01
Position
12:complement(10069554..10098985)
AA seq 280 aa
MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLV
LLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEK
LCRELYNKAGAHRCSPCTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQED
LEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAIL
NGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD
NT seq 843 nt   +upstreamnt  +downstreamnt
atgcaggccaagtacagcagcacgagggacatgctggatgatgatggggacaccaccatg
agcctgcattctcaaggctctgccacaactcggcatccagagccccggcgcacagagcac
agggctccctcttcaacgtggcgaccagtggccctgaccctgctgactttgtgcttggtg
ctgctgatagggctggcagccctggggcttttgttttttcagtactaccagctctccaat
actggtcaagacaccatttctcaaatggaagaaagattaggaaatacgtcccaagagttg
caatctcttcaagtccagaatataaagcttgcaggaagtctgcagcatgtggctgaaaaa
ctctgtcgtgagctgtataacaaagctggagcacacaggtgcagcccttgtacagaacaa
tggaaatggcatggagacaattgctaccagttctataaagacagcaaaagttgggaggac
tgtaaatatttctgccttagtgaaaactctaccatgctgaagataaacaaacaagaagac
ctggaatttgccgcgtctcagagctactctgagtttttctactcttattggacagggctt
ttgcgccctgacagtggcaaggcctggctgtggatggatggaacccctttcacttctgaa
ctgttccatattataatagatgtcaccagcccaagaagcagagactgtgtggccatcctt
aatgggatgatcttctcaaaggactgcaaagaattgaagcgttgtgtctgtgagagaagg
gcaggaatggtgaagccagagagcctccatgtcccccctgaaacattaggcgaaggtgac
tga

DBGET integrated database retrieval system