KEGG   Homo sapiens (human): 51272Help
Entry
51272             CDS       T01001                                 

Gene name
BET1L, BET1L1, GOLIM3, GS15, HSPC197
Definition
(RefSeq) Bet1 golgi vesicular membrane trafficking protein like
  KO
K08504  blocked early in transport 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    51272 (BET1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    51272 (BET1L)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[C] (Qc)
   Bet1
    51272 (BET1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2207 DUF2273 Sec20
Motif
Other DBs
NCBI-GeneID: 51272
NCBI-ProteinID: NP_001092257
OMIM: 615417
HGNC: 19348
Ensembl: ENSG00000177951
Vega: OTTHUMG00000119071
Pharos: Q9NYM9(Tbio)
UniProt: Q9NYM9
Position
11p15.5
AA seq 111 aa AA seqDB search
MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMDSDF
TSMTSLLTGSVKRFSTMARSGQDNRKLLCGMAVGLIVAFFILSYFLSRART
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcggactgggctcgggctcagagcccgggcgctgtggaagagattctagaccgggag
aacaagcgaatggctgacagcctggcctccaaagtcaccaggctcaaatcgctcgccctg
gacatcgatagggatgcagaggatcagaaccggtacctggatggcatggactcggatttc
acaagcatgaccagcctgcttacagggagcgtgaagcgcttttccacaatggcaaggtcc
ggacaagacaaccggaagcttctatgtggcatggccgtgggtctaattgtggccttcttc
atcctctcctacttcttgtccagggcaaggacgtga

DBGET integrated database retrieval system