KEGG   Homo sapiens (human): 51280Help
Entry
51280             CDS       T01001                                 

Gene name
GOLM1, C9orf155, GOLPH2, GP73, HEL46, PSEC0257, bA379P1.3
Definition
(RefSeq) golgi membrane protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Allexi_40kDa GreA_GreB_N
Motif
Other DBs
NCBI-GeneID: 51280
NCBI-ProteinID: NP_057632
OMIM: 606804
HGNC: 15451
Ensembl: ENSG00000135052
Vega: OTTHUMG00000020130
Pharos: Q8NBJ4(Tbio)
UniProt: Q8NBJ4 B3KNK9
Position
9q21.33
AA seq 401 aa AA seqDB search
MMGLGNGRRSMKSPPLVLAALVACIIVLGFNYWIASSRSVDLQTRIMELEGRVRRAAAER
GAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVL
QDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKK
GNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSS
EVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTP
QVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAES
ETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgggcttgggaaacgggcgtcgcagcatgaagtcgccgcccctcgtgctggccgcc
ctggtggcctgcatcatcgtcttgggcttcaactactggattgcgagctcccggagcgtg
gacctccagacacggatcatggagctggaaggcagggtccgcagggcggctgcagagaga
ggcgccgtggagctgaagaagaacgagttccagggagagctggagaagcagcgggagcag
cttgacaaaatccagtccagccacaacttccagctggagagcgtcaacaagctgtaccag
gacgaaaaggcggttttggtgaataacatcaccacaggtgagaggctcatccgagtgctg
caagaccagttaaagaccctgcagaggaattacggcaggctgcagcaggatgtcctccag
tttcagaagaaccagaccaacctggagaggaagttctcctacgacctgagccagtgcatc
aatcagatgaaggaggtgaaggaacagtgtgaggagcgaatagaagaggtcaccaaaaag
gggaatgaagctgtagcttccagagacctgagtgaaaacaacgaccagagacagcagctc
caagccctcagtgagcctcagcccaggctgcaggcagcaggcctgccacacacagaggtg
ccacaagggaagggaaacgtgcttggtaacagcaagtcccagacaccagcccccagttcc
gaagtggttttggattcaaagagacaagttgagaaagaggaaaccaatgagatccaggtg
gtgaatgaggagcctcagagggacaggctgccgcaggagccaggccgggagcaggtggtg
gaagacagacctgtaggtggaagaggcttcgggggagccggagaactgggccagacccca
caggtgcaggctgccctgtcagtgagccaggaaaatccagagatggagggccctgagcga
gaccagcttgtcatccccgacggacaggaggaggagcaggaagctgccggggaagggaga
aaccagcagaaactgagaggagaagatgactacaacatggatgaaaatgaagcagaatct
gagacagacaagcaagcagccctggcagggaatgacagaaacatagatgtttttaatgtt
gaagatcagaaaagagacaccataaatttacttgatcagcgtgaaaagcggaatcataca
ctctga

DBGET integrated database retrieval system