KEGG   Homo sapiens (human): 51283
Entry
51283             CDS       T01001                                 

Gene name
BFAR, BAR, RNF47
Definition
(RefSeq) bifunctional apoptosis regulator
  KO
K15684  bifunctional apoptosis regulator
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    51283 (BFAR)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    51283 (BFAR)
SSDB
Motif
Pfam: SAM_1 zf-C3HC4_4 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 SAM_2 SAM_PNT zf-ANAPC11 zf-RING_10 zf-RING_5 zf-rbx1 Prok-RING_4
Other DBs
NCBI-GeneID: 51283
NCBI-ProteinID: NP_057645
HGNC: 17613
Ensembl: ENSG00000103429
Vega: OTTHUMG00000129848
Pharos: Q9NZS9(Tbio)
UniProt: Q9NZS9
Position
16p13.12
AA seq 450 aa
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLAL
WWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQ
KYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVA
KWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAIL
MELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIH
TICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSR
FLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCN
CLFYWALYFNPIINIDLVVKELRRLETQVL
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggaggaacctcagaaaagctatgtgaacacaatggaccttgagagagatgaacctctc
aaaagcaccggccctcagatttctgttagtgaattttcttgccactgctgctacgacatc
ctggttaaccccaccaccttgaactgtgggcacagcttctgccgtcactgccttgcttta
tggtgggcatcttcaaagaaaacagaatgtccagaatgcagagaaaaatgggaaggtttc
cccaaagtcagtattctcctcagggatgccattgaaaagttatttcctgatgccattaga
ctgagatttgaagacattcagcagaataatgacatagtccaaagtcttgcagcctttcag
aaatatgggaatgatcagattcctttagctcctaacacaggccgagcgaatcagcagatg
ggagggggattcttttccggtgtgctcacagctttaactggagtggcagtggtcctgctc
gtctatcactggagcagcagggaatctgaacacgacctcctggtccacaaggctgtggcc
aaatggacggcggaagaagttgtcctctggctggagcagctgggcccttgggcatctctt
tacagggaaaggtttttatctgaacgagtaaatggaaggttgcttttaactttgacagag
gaagaattttccaagacgccctataccatagaaaacagcagccacaggagagccatcctc
atggagctagaacgtgtcaaagcattaggcgtgaagcccccccagaatctctgggaatat
aaggctgtgaacccaggcaggtccctgttcctgctatacgccctcaagagctcccccagg
ctgagtctgctctacctgtacctgtttgactacaccgacaccttcctacctttcatccac
accatctgccctctgcaagaagacagctctggggaggacatcgtcaccaagcttctggat
cttaaggagcctacgtggaagcagtggagagagttcctggtcaaatactccttccttcca
taccagctgattgctgagtttgcttgggactggttggaggtccattactggacatcacgg
tttctcatcatcaatgctatgttactctcagttctggaattattctccttttggagaatc
tggtcgagaagtgaactgaagaccgtgcctcagaggatgtggagccatttctggaaagta
tcaacgcaggggctttttgtggccatgttctggcccctcatccctcagtttgtttgcaac
tgtttgttttactgggccctgtactttaacccaattattaacattgatcttgtggtcaag
gaactccggcggctggaaacccaggtgttgtga

DBGET integrated database retrieval system