KEGG   Homo sapiens (human): 5129Help
Entry
5129              CDS       T01001                                 

Gene name
CDK18, PCTAIRE, PCTAIRE3, PCTK3
Definition
(RefSeq) cyclin dependent kinase 18
  KO
K15596  cyclin-dependent kinase 18 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5129 (CDK18)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     5129 (CDK18)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   5129 (CDK18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Kdo APH
Motif
Other DBs
NCBI-GeneID: 5129
NCBI-ProteinID: NP_002587
OMIM: 169190
HGNC: 8751
Ensembl: ENSG00000117266
Vega: OTTHUMG00000037203
Pharos: Q07002(Tbio)
UniProt: Q07002 A0A024R996 Q59G02
Position
1q32.1
AA seq 474 aa AA seqDB search
MIMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECST
FSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDL
PKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHE
EGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMH
NVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNE
VVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTP
TEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAAL
SHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgaacaagatgaagaactttaagcgccgtttctccctgtcagtgccccgcact
gagaccattgaagaatccttggctgaattcacggagcaattcaaccagctccacaaccgg
cggaatgagaacttgcagctcggtcctcttggcagagaccccccgcaggagtgcagcacc
ttctccccaacagacagcggggaggagccggggcagctctcccctggcgtgcagttccag
cggcggcagaaccagcgccgcttctccatggaggacgtcagcaagaggctctctctgccc
atggatatccgcctgccccaggaattcctacagaagctacagatggagagcccagatctg
cccaagccgctcagccgcatgtcccgccgggcctccctgtcagacattggctttgggaaa
ctggaaacatacgtgaaactggacaaactgggagagggcacctatgccacagtcttcaaa
gggcgcagcaaactgacggagaaccttgtggccctgaaagagatccggctggagcacgag
gagggagcgccctgcactgccatccgagaggtgtctctgctgaagaacctgaagcacgcc
aatattgtgaccctgcatgacctcatccacacagatcggtccctcaccctggtgtttgag
tacctggacagtgacctgaagcagtatctggaccactgtgggaacctcatgagcatgcac
aacgtcaagattttcatgttccagctgctccggggcctcgcctactgtcaccaccgcaag
atcctgcaccgggacctgaagccccagaacctgctcatcaacgagaggggggagctgaag
ctggccgactttggactggccagggccaagtcagtgcccacaaagacttactccaatgag
gtggtgaccctgtggtacaggccccccgatgtgctgctgggatccacagagtactccacc
cccattgatatgtggggcgtgggctgcatccactacgagatggccacagggaggcccctc
ttcccgggctccacagtcaaggaggagctgcacctcatctttcgcctcctcgggaccccc
acagaagagacgtggcccggcgtgaccgccttctctgagttccgcacctacagcttcccc
tgctacctcccgcagccgctcatcaaccacgcgcccaggttggatacggatggcatccac
ctcctgagcagcctgctcctgtatgaatccaagagtcgcatgtcagcagaggctgccctg
agtcactcctacttccggtctctgggagagcgtgtgcaccagcttgaagacactgcctcc
atcttctccctgaaggagatccagctccagaaggacccaggctaccgaggcttggccttc
cagcagccaggacgagggaagaacaggcggcagagcatcttctga

DBGET integrated database retrieval system